close all open/close all

CDS information : Chro_00180


close this sectionLocation

Organism
StrainATCC 13273 (=NBRC 3746)
Entry nameChromomycin
Contig
Start / Stop / Direction18,623 / 19,804 / + [in whole cluster]
18,623 / 19,804 / + [in contig]
Location18623..19804 [in whole cluster]
18623..19804 [in contig]
TypeCDS
Length1,182 bp (393 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductD-oliose glycosyltransferase
Product (GenBank)glycosyltransferase
Gene
Gene (GenBank)cmmGI
EC number
Keyword
  • disaccharide 2nd D-oliose
Note
Note (GenBank)
Reference
ACC
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
[16391039] Deoxysugar transfer during chromomycin A3 biosynthesis in Streptomyces griseus subsp. griseus: new derivatives with antitumor activity. (Appl Environ Microbiol. , 2006)

close this sectionSequence

selected fasta
>D-oliose glycosyltransferase [glycosyltransferase]
MRVLLTTAAWPSHYMFMVPLAWAFRAAGHEVRVAAQPHVVETVLKSGLTAVPVGPDVDFA
QLHRKFVAETDPAQYRSRDAIITIFHRVAEMMAPDLVRFAESWKPDLVIRDPVAFAASVA
AEVSGAPLVRHAWGPDVYATDPGKWLAHHVLERLGPTYELYGVRPPDTFDRLAVDPTPPS
LHLDASGPSLPLRYVPYNGPGVVPPWVLGTPDRPRVCVTWGTFTSTATAELDMFLVPTVL
DALAGLDVEPVVAVTGAERELLGDVGGRARIVQDLPIHTVLPSCSAVVHHGGATTVLSAA
RFGVPQLTMPHLFEQRLNSDLLEAAGAGVQLTAAHADAESIGAAVTELLRGDAPYAVASR
GLRDEIEAMPSPLETVALIEETLPRGARADTGD
selected fasta
>D-oliose glycosyltransferase [glycosyltransferase]
ATGCGTGTTCTGCTGACCACCGCGGCCTGGCCGTCGCACTACATGTTCATGGTCCCGCTC
GCCTGGGCCTTTCGCGCCGCCGGGCACGAGGTGCGCGTCGCGGCCCAGCCGCACGTGGTG
GAGACCGTGCTGAAGTCGGGCCTGACCGCTGTACCCGTGGGCCCCGACGTCGACTTCGCC
CAGCTGCACCGGAAGTTCGTCGCCGAGACCGACCCCGCCCAGTACCGGAGCCGGGACGCC
ATCATCACGATCTTCCACCGGGTCGCGGAGATGATGGCCCCCGATCTCGTTCGGTTCGCC
GAGTCCTGGAAGCCCGACCTCGTCATCCGGGACCCGGTGGCCTTCGCGGCGTCCGTCGCC
GCCGAGGTGTCCGGCGCCCCGCTGGTCCGGCACGCGTGGGGCCCCGACGTGTACGCCACC
GACCCGGGGAAGTGGCTCGCGCACCACGTCCTGGAACGGCTCGGCCCCACCTACGAGTTG
TACGGGGTACGGCCGCCGGACACCTTCGACCGGCTCGCCGTCGACCCGACCCCGCCGAGC
CTGCACCTCGACGCCTCCGGCCCGTCGCTGCCCCTGCGCTACGTGCCGTACAACGGGCCG
GGCGTGGTGCCGCCCTGGGTCCTCGGAACACCGGACCGCCCCAGGGTCTGCGTCACGTGG
GGCACCTTCACGTCCACCGCGACGGCCGAGCTGGACATGTTCCTGGTCCCGACGGTGCTC
GACGCCCTCGCCGGCCTGGACGTGGAGCCGGTAGTCGCGGTGACCGGGGCGGAGCGGGAG
CTGCTGGGCGACGTGGGAGGCCGGGCCAGGATCGTGCAGGACCTCCCCATCCACACGGTG
CTGCCCAGCTGCTCCGCCGTGGTCCACCACGGCGGAGCGACGACCGTCCTGTCCGCGGCC
CGCTTCGGAGTGCCCCAGCTGACCATGCCGCACCTGTTCGAGCAACGCCTCAACTCGGAC
CTGCTGGAGGCGGCCGGTGCCGGTGTCCAGCTCACCGCGGCGCACGCCGACGCCGAGTCC
ATCGGTGCCGCGGTGACGGAGCTGCTTCGCGGGGACGCGCCGTACGCGGTGGCCTCGCGC
GGGCTGCGGGACGAGATCGAGGCCATGCCGTCCCCGCTCGAGACCGTCGCCCTCATCGAG
GAGACGCTCCCGCGCGGTGCGCGCGCGGACACCGGAGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [17-135]  9e-15 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [174-265]  5.5e-27 PF06722
PF06722   DUF1205
SignalP
 [1-23]  0.566 Signal
Bacteria, Gram-negative   
 [1-23]  0.982 Signal
Eukaryota   
 [1-23]  0.411 Signal
Bacteria, Gram-positive   
TMHMM No significant hit