close all open/close all

CDS information : Chro_00200


close this sectionLocation

Organism
StrainATCC 13273 (=NBRC 3746)
Entry nameChromomycin
Contig
Start / Stop / Direction21,346 / 22,329 / + [in whole cluster]
21,346 / 22,329 / + [in contig]
Location21346..22329 [in whole cluster]
21346..22329 [in contig]
TypeCDS
Length984 bp (327 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative C-4' ketoreductase
Product (GenBank)side-chain ketoreductase
Gene
Gene (GenBank)cmmWI
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
Related Reference
ACC
Q194Q1
NITE
Mith_00240
PmId
[12733914] Mithramycin SK, a novel antitumor drug with improved therapeutic index, mithramycin SA, and demycarosyl-mithramycin SK: three new products generated in the mithramycin producer Streptomyces argillaceus through combinatorial biosynthesis. (J Am Chem Soc. , 2003)
[16571899] Novel GC-rich DNA-binding compound produced by a genetically engineered mutant of the mithramycin producer Streptomyces argillaceus exhibits improved transcriptional repressor activity: implications for cancer therapy. (Nucleic Acids Res. , 2006)

close this sectionSequence

selected fasta
>putative C-4' ketoreductase [side-chain ketoreductase]
MEHRYLGRSGLRISEIVFGNLLYPQDSTPDGTVLGCLRTALDEGVTTFDTADIYGMGRSE
ELLGRALAGEPRDGVVICTKVFFPAGNGPNGSGLSRKHVREGLEASLRRLDTDYVDLYTA
HRYDPNTPLEETMLAFADLVRAGKVLYMGVSEWTPEQIGEAAALAKELGVHLIYNMPQYS
ALWREPEARVMPACERLGIGVVPYFTLAQGVLSGKYLPGRPAPEDSRGGAELIGGRARFM
RRFLADDVLERVQRLAGPASEAGLTLSQLAMAWVLRQPGVAGAVVGASRPEQVRENAAAS
GVKLDPGLVERIDEVLGPVAEYGAADA
selected fasta
>putative C-4' ketoreductase [side-chain ketoreductase]
ATGGAACACCGGTACCTGGGGCGCAGCGGACTGCGCATCAGCGAGATCGTCTTCGGCAAT
CTGCTCTATCCGCAGGACAGCACGCCCGACGGGACGGTGCTCGGCTGTCTGCGCACGGCG
CTGGACGAGGGCGTCACGACGTTCGACACCGCGGACATCTACGGGATGGGGCGTTCGGAG
GAGCTCCTGGGCAGGGCCCTCGCCGGCGAGCCGCGTGACGGGGTGGTGATCTGTACCAAG
GTCTTCTTCCCGGCTGGTAACGGGCCGAACGGCTCGGGGCTCTCCCGCAAACACGTCCGT
GAAGGTCTCGAAGCCTCGCTGCGGCGGCTGGACACCGACTACGTCGACCTCTACACGGCC
CATCGCTACGACCCGAACACCCCGCTGGAAGAGACCATGCTCGCCTTCGCTGACCTGGTG
CGCGCCGGCAAGGTCCTCTACATGGGAGTCTCGGAATGGACCCCCGAGCAGATCGGCGAG
GCGGCGGCACTGGCGAAGGAGCTGGGGGTCCACCTCATCTACAACATGCCCCAGTACTCG
GCGCTCTGGCGTGAGCCCGAGGCGCGGGTGATGCCCGCCTGCGAGCGCCTCGGCATCGGG
GTGGTGCCCTACTTCACCCTCGCCCAGGGGGTGCTGAGCGGAAAGTACCTGCCCGGCAGG
CCAGCGCCCGAGGACTCACGGGGCGGTGCCGAACTGATCGGCGGCCGGGCCAGGTTCATG
CGGCGCTTCCTTGCGGACGATGTGCTCGAGCGGGTCCAGCGGCTGGCGGGGCCCGCCTCG
GAGGCGGGGCTGACGCTCTCCCAGCTCGCCATGGCCTGGGTGCTGCGGCAGCCGGGCGTG
GCGGGCGCCGTCGTCGGGGCGTCCCGGCCGGAGCAGGTGAGGGAGAACGCCGCGGCCTCC
GGGGTGAAACTCGACCCCGGCCTGGTGGAGCGGATCGACGAGGTGCTCGGCCCGGTGGCG
GAGTACGGGGCGGCCGATGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR023210 NADP-dependent oxidoreductase domain (Domain)
 [1-317]  7.79999999999999e-94 G3DSA:3.20.20.100
G3DSA:3.20.20.100   Aldo/ket_red
 [1-324]  1.3000049540733e-93 SSF51430
SSF51430   Aldo/ket_red
 [15-315]  5.59999999999999e-72 PF00248
PF00248   Aldo_ket_red
SignalP No significant hit
TMHMM No significant hit