close all open/close all

CDS information : Chro_00210


close this sectionLocation

Organism
StrainATCC 13273 (=NBRC 3746)
Entry nameChromomycin
Contig
Start / Stop / Direction22,349 / 23,590 / + [in whole cluster]
22,349 / 23,590 / + [in contig]
Location22349..23590 [in whole cluster]
22349..23590 [in contig]
TypeCDS
Length1,242 bp (413 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative ligase
Product (GenBank)acyl CoA ligase
Gene
Gene (GenBank)cmmLI
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
Related Reference
ACC
Q8GHC3
PmId
[15123279] In vitro and in vivo production of new aminocoumarins by a combined biochemical, genetic, and synthetic approach. (Chem Biol. , 2004)
ACC
Q9L9F6
PmId
[10801869] Cloning, overexpression, and purification of novobiocic acid synthetase from Streptomyces spheroides NCIMB 11891. (J Biol Chem. , 2000)
ACC
Q9EY88
PmId
[11152072] Identification of Amycolatopsis sp. strain HR167 genes, involved in the bioconversion of ferulic acid to vanillin. (Appl Microbiol Biotechnol. , 2000)

close this sectionSequence

selected fasta
>putative ligase [acyl CoA ligase]
MEDRLCARPAARYVTELFTGLHRWSGRIALRTGKRQITFDELLAQSYRIARALERMGHSR
HEGIVCLTANPPELVALRLAAHLLGSRFTALNVNVPGDVTGWRGILASVRPAVFLVDRRG
AEVLGEPVPGTLTLGVPEAGCDLLARAAEESGEPLAPRAREEDIALLVPSHGTTGPRRGA
VHRFSGMRVDWRRPEEGALGDFPAGITTLAVSPLAGNAGEVVLMLLRQGCTALLMDDFDP
GRVLATVEAERITSVYLLSGHLRRLLAHPDVGRTDLSSLRYVPYGNAPVPAATVRRAVEV
FGPVLAQNYLSSEIRAITLLRQEDHLAAAARRPELLRSVGRALPEVEIRIRGPRDEPLPC
GACGEVWLRAPHMMSGYWRDPAGTARVMRGGWLHSGDRGRLDEEGYLYLTGRA
selected fasta
>putative ligase [acyl CoA ligase]
GTGGAGGACCGGCTGTGCGCCAGGCCAGCCGCCCGCTATGTGACCGAGCTCTTCACCGGG
CTCCACCGGTGGTCCGGCCGGATCGCGCTGCGGACGGGGAAGCGGCAGATCACGTTCGAC
GAGCTGCTGGCCCAGAGCTACCGGATCGCCCGCGCGCTGGAGCGGATGGGGCACAGCCGC
CATGAGGGCATCGTGTGCCTCACGGCGAACCCGCCCGAGCTGGTAGCCCTGCGGCTCGCC
GCCCACCTGCTGGGCAGCCGCTTCACCGCGCTCAACGTCAACGTGCCGGGGGATGTGACA
GGCTGGCGCGGGATCCTCGCCTCCGTGCGGCCCGCGGTCTTCCTGGTGGACCGGCGGGGC
GCCGAGGTGCTGGGGGAGCCGGTGCCCGGAACGCTGACGCTGGGAGTGCCGGAGGCGGGG
TGCGACCTGCTGGCCCGGGCCGCCGAGGAGTCCGGGGAGCCGTTGGCGCCGCGCGCCCGG
GAGGAGGACATCGCCCTGCTGGTCCCGTCGCACGGTACGACGGGTCCCCGGCGGGGAGCC
GTCCACCGGTTCTCCGGGATGAGGGTCGACTGGCGCCGCCCGGAGGAAGGCGCACTCGGC
GATTTCCCGGCCGGGATCACCACCCTGGCGGTCAGCCCGCTGGCGGGGAACGCGGGGGAG
GTCGTGCTCATGCTCCTCAGGCAGGGTTGCACCGCTCTGCTCATGGACGACTTCGACCCG
GGCCGGGTGCTCGCGACCGTCGAGGCCGAGCGGATCACCAGCGTGTACCTGCTCTCCGGT
CACCTGCGGCGGCTGCTCGCCCACCCGGATGTCGGCCGGACGGACCTGTCCAGCCTGCGC
TATGTGCCGTACGGTAACGCGCCTGTCCCGGCCGCCACCGTGCGGCGGGCGGTCGAGGTC
TTCGGCCCGGTCCTGGCACAGAACTACCTCAGCAGCGAGATCCGGGCCATCACCCTCCTG
CGGCAGGAGGACCACCTGGCCGCCGCGGCGCGCCGGCCGGAGCTGCTGCGGTCCGTCGGA
CGGGCGCTGCCCGAGGTCGAGATCCGGATACGCGGGCCCCGGGACGAGCCGCTTCCCTGC
GGCGCGTGTGGCGAGGTCTGGCTGCGCGCCCCGCACATGATGAGCGGCTACTGGCGCGAT
CCGGCCGGGACGGCCCGGGTCATGCGCGGAGGCTGGCTGCACTCCGGCGACCGGGGCCGG
CTGGACGAGGAGGGCTACCTCTATCTCACCGGCCGCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [38-413]  1.9e-52 PF00501
PF00501   AMP-binding
SignalP No significant hit
TMHMM No significant hit