close all open/close all

CDS information : Chro_00220


close this sectionLocation

Organism
StrainATCC 13273 (=NBRC 3746)
Entry nameChromomycin
Contig
Start / Stop / Direction24,395 / 23,643 / - [in whole cluster]
24,395 / 23,643 / - [in contig]
Locationcomplement(23643..24395) [in whole cluster]
complement(23643..24395) [in contig]
TypeCDS
Length753 bp (250 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productchromomycin resistance ABC transporter permease protein
Product (GenBank)membrane protein
Gene
Gene (GenBank)cmrB
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
[17768249] Involvement of a chromomycin ABC transporter system in secretion of a deacetylated precursor during chromomycin biosynthesis. (Microbiology. , 2007)
Related Reference
ACC
Q194P0
NITE
Mith_00350
PmId
[8757400] An ABC transporter is essential for resistance to the antitumor agent mithramycin in the producer Streptomyces argillaceus. (Mol Gen Genet. , 1996)

close this sectionSequence

selected fasta
>chromomycin resistance ABC transporter permease protein [membrane protein]
MKTLRETLLVFDNQLRFTFRYKITIVLGMVQPVLYLLLFGPLLTKLGGMGSGNTWQTFVP
GVLVYLALFGAGFCGFGIISDVRSGVIERMRVTPVSRFALLMGRVSREVAILLTQSVIIV
SVGFLLGLRAGFLGILGAVVLVVLLGIALASLSLSLGVALKSEDQFAPLLTSAALPVMLL
AGILLPMDLAPKWLDYLSHLNPLRYIVDAIRDLFADQFATRAVLEGTCVAIVLAVVCVAL
GIRTFSKENA
selected fasta
>chromomycin resistance ABC transporter permease protein [membrane protein]
GTGAAGACCCTCCGTGAGACCTTACTCGTCTTCGACAACCAGCTCCGGTTCACCTTCCGG
TACAAGATCACCATCGTGCTGGGCATGGTCCAGCCCGTCCTCTACCTCCTGCTCTTCGGC
CCGCTGCTGACCAAGCTCGGCGGCATGGGCAGCGGCAACACCTGGCAGACGTTCGTCCCC
GGGGTCCTCGTGTACCTCGCACTGTTCGGCGCCGGCTTCTGCGGTTTCGGCATCATCTCC
GACGTACGCTCGGGCGTCATCGAGCGGATGCGTGTCACCCCGGTCAGTCGCTTCGCGCTG
CTCATGGGACGGGTGTCGCGCGAGGTCGCGATCCTCCTCACCCAGTCCGTCATCATCGTC
TCCGTGGGCTTCCTCCTCGGACTGCGCGCCGGCTTCCTGGGGATCCTGGGCGCCGTCGTC
CTCGTCGTGCTGCTCGGCATCGCGCTCGCGTCGCTCTCGCTGTCGCTGGGTGTCGCGCTG
AAGTCGGAGGACCAGTTCGCCCCGCTGCTGACCTCTGCCGCGCTGCCCGTCATGCTGCTG
GCCGGCATCCTGCTGCCGATGGACCTGGCGCCGAAGTGGCTGGACTACCTGTCCCACCTC
AACCCCCTGCGCTACATCGTGGACGCCATCCGGGACCTGTTCGCCGACCAGTTCGCCACC
AGGGCGGTCCTGGAGGGAACGTGCGTCGCGATCGTGCTCGCGGTGGTCTGCGTCGCCCTC
GGCATCCGGACCTTCTCCAAGGAGAACGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000412 ABC-2 (Family)
 [23-248]  PS51012
PS51012   ABC_TM2
IPR013525 ABC-2 type transporter (Domain)
 [9-213]  8.70000000000003e-31 PF01061
PF01061   ABC2_membrane
IPR013526 ABC-2 transporter (Family)
 [25-46]  9.30000048475975e-07 PR00164 [101-126]  9.30000048475975e-07 PR00164 [135-159]  9.30000048475975e-07 PR00164 [172-191]  9.30000048475975e-07 PR00164 [192-211]  9.30000048475975e-07 PR00164
PR00164   ABC2TRNSPORT
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [21-43]  Transmembrane (i-o) [58-80]  Transmembrane (o-i) [109-128]  Transmembrane (i-o) [132-154]  Transmembrane (o-i) [166-185]  Transmembrane (i-o) [223-245]  Transmembrane (o-i)
Transmembrane 6