close all open/close all

CDS information : Chro_00230


close this sectionLocation

Organism
StrainATCC 13273 (=NBRC 3746)
Entry nameChromomycin
Contig
Start / Stop / Direction25,387 / 24,410 / - [in whole cluster]
25,387 / 24,410 / - [in contig]
Locationcomplement(24410..25387) [in whole cluster]
complement(24410..25387) [in contig]
TypeCDS
Length978 bp (325 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productchromomycin resistance ABC transporter ATP-binding protein
Product (GenBank)ATP-binding protein
Gene
Gene (GenBank)cmrA
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
[17768249] Involvement of a chromomycin ABC transporter system in secretion of a deacetylated precursor during chromomycin biosynthesis. (Microbiology. , 2007)
Related Reference
ACC
Q194P1
NITE
Mith_00340
PmId
[8757400] An ABC transporter is essential for resistance to the antitumor agent mithramycin in the producer Streptomyces argillaceus. (Mol Gen Genet. , 1996)

close this sectionSequence

selected fasta
>chromomycin resistance ABC transporter ATP-binding protein [ATP-binding protein]
MIEVHGLSRTFQAPQGEVNAVRGVDFTVAAGEIVGFLGPNGAGKTTTMRMLTTLLRPTSG
TAVIAGHDLLGDPVGVRRRIGYVAQGGGANPAESVVNELILQARLYGLSKSEARSRITAL
AGRLGLDGLEGRLVSSLSGGQRRRLDIALGLVHQPPLIFLDEPSTGLDPTSRNNLWDHIR
KLRDELGATVFLSTHYLDEADALCDRILIMDRGTILVEDSPEELKGRSRADTVTVEVAPE
GVAPATAVIERLPSARSVIPGGTTIRFRTEHSSRTMVDVMHALESSAVDIVSIQVDRPSL
DDVFLALTGQPTEELHAAATAPAGA
selected fasta
>chromomycin resistance ABC transporter ATP-binding protein [ATP-binding protein]
ATGATCGAAGTACACGGCCTGTCCCGGACGTTTCAGGCGCCGCAGGGCGAGGTGAACGCC
GTCCGCGGTGTCGACTTCACCGTCGCCGCGGGGGAGATCGTTGGTTTCCTCGGTCCCAAC
GGCGCGGGCAAGACCACCACGATGCGGATGCTCACGACACTGCTACGCCCCACCTCGGGA
ACAGCCGTGATCGCGGGCCACGACCTGCTCGGCGACCCGGTCGGCGTCCGCAGGCGGATC
GGTTACGTCGCCCAGGGCGGCGGGGCGAATCCCGCGGAGTCCGTGGTCAACGAACTCATT
CTCCAGGCCCGGCTGTACGGACTCTCCAAGAGCGAGGCACGGTCACGCATCACCGCCCTG
GCGGGCCGGCTGGGTCTCGACGGGCTGGAGGGCCGGCTCGTCAGCAGTCTGTCCGGCGGT
CAGCGGCGGCGGCTCGACATCGCGCTCGGCCTGGTGCACCAGCCTCCGCTGATCTTCCTG
GACGAACCCAGCACCGGACTCGACCCGACCAGCCGCAACAACCTCTGGGACCACATCCGC
AAACTGCGCGACGAGCTCGGCGCCACCGTCTTCCTCAGCACTCACTACCTCGACGAGGCG
GACGCCCTGTGTGACCGCATCCTCATCATGGACCGCGGCACCATCCTCGTGGAGGACAGT
CCGGAGGAGCTCAAGGGGCGATCTCGGGCAGACACGGTGACCGTCGAGGTCGCCCCGGAG
GGCGTCGCGCCCGCCACCGCCGTCATCGAGCGGCTGCCGTCGGCCCGTTCGGTGATCCCC
GGCGGAACCACCATCCGCTTCCGCACCGAACACAGCAGCCGGACCATGGTCGACGTCATG
CACGCGCTGGAATCGAGCGCGGTCGACATCGTCTCCATCCAGGTCGACCGTCCGAGCCTC
GACGACGTCTTCCTCGCCCTCACCGGACAGCCGACCGAAGAACTGCACGCCGCCGCAACC
GCCCCCGCCGGCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003439 ABC transporter-like (Domain)
 [2-237]  PS50893
PS50893   ABC_TRANSPORTER_2
 [45-164]  1e-16 PF00005
PF00005   ABC_tran
IPR003593 AAA+ ATPase domain (Domain)
 [30-222]  5.69999708783953e-16 SM00382
SM00382   AAA
IPR017871 ABC transporter, conserved site (Conserved_site)
 [137-151]  PS00211
PS00211   ABC_TRANSPORTER_1
SignalP No significant hit
TMHMM No significant hit