close all open/close all

CDS information : Chro_00240


close this sectionLocation

Organism
StrainATCC 13273 (=NBRC 3746)
Entry nameChromomycin
Contig
Start / Stop / Direction25,986 / 25,390 / - [in whole cluster]
25,986 / 25,390 / - [in contig]
Locationcomplement(25390..25986) [in whole cluster]
complement(25390..25986) [in contig]
TypeCDS
Length597 bp (198 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductPadR family transcriptional repressor
Product (GenBank)transcriptional regulator
Gene
Gene (GenBank)cmmRII
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
[17768249] Involvement of a chromomycin ABC transporter system in secretion of a deacetylated precursor during chromomycin biosynthesis. (Microbiology. , 2007)
Family/Domain
FD
IPR005149

close this sectionSequence

selected fasta
>PadR family transcriptional repressor [transcriptional regulator]
MALGTLQNVGPLHGHEIRRIAEVTSVSSWGGVSVGALYRELRTMDEGGLVESVRTEQVGR
RPARTVYRITPSGEGELRDLREQAVTQVHHGTDPFGVALLFTRTSELPTLLDLLERRREA
VLTMRNDIEAESRALREAGQIGPLDAAMFRRRVMQLDADLLWQDELDRTITETVAAEQRV
GEELPADGTTGPTAEVSP
selected fasta
>PadR family transcriptional repressor [transcriptional regulator]
ATGGCTCTCGGGACCCTTCAGAACGTGGGACCGCTCCACGGCCACGAGATCCGCCGCATC
GCGGAAGTGACCAGCGTCAGCAGTTGGGGAGGCGTCAGCGTCGGCGCGCTCTACCGCGAG
CTGCGCACGATGGACGAAGGCGGCCTGGTCGAATCCGTCCGCACGGAACAGGTGGGCAGA
CGCCCCGCCAGGACCGTGTACCGGATCACCCCCTCGGGAGAGGGCGAGCTGCGCGACCTG
CGTGAGCAGGCGGTCACCCAGGTGCACCACGGGACGGATCCGTTCGGCGTCGCCCTCCTC
TTCACCCGCACCAGCGAACTGCCGACCCTTCTGGACCTGCTGGAGCGGCGCCGCGAAGCC
GTCCTGACCATGCGCAACGACATCGAGGCCGAGAGCCGCGCGCTGCGCGAGGCCGGCCAG
ATCGGGCCGCTCGATGCCGCGATGTTCCGGCGCAGGGTGATGCAGCTCGACGCGGACCTG
CTCTGGCAGGACGAACTCGACCGGACGATCACCGAGACGGTCGCGGCCGAACAACGCGTC
GGCGAGGAGCTTCCCGCCGACGGGACCACCGGACCCACAGCGGAGGTATCACCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005149 Transcription regulator PadR N-terminal (Domain)
 [3-78]  2e-10 PF03551
PF03551   PadR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [3-83]  6.80000000000001e-14 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit