close all open/close all

CDS information : Chro_00250


close this sectionLocation

Organism
StrainATCC 13273 (=NBRC 3746)
Entry nameChromomycin
Contig
Start / Stop / Direction26,082 / 28,562 / + [in whole cluster]
26,082 / 28,562 / + [in contig]
Location26082..28562 [in whole cluster]
26082..28562 [in contig]
TypeCDS
Length2,481 bp (826 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
ProductUvrA-like protein
Product (GenBank)UV-repair protein
Gene
Gene (GenBank)cmrX
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
[17768249] Involvement of a chromomycin ABC transporter system in secretion of a deacetylated precursor during chromomycin biosynthesis. (Microbiology. , 2007)
Related Reference
ACC
Q194P3
NITE
Mith_00320
PmId
[8757400] An ABC transporter is essential for resistance to the antitumor agent mithramycin in the producer Streptomyces argillaceus. (Mol Gen Genet. , 1996)
[10779713] Insertional inactivation of mtrX and mtrY genes from the mithramycin gene cluster affects production and growth of the producer organism Streptomyces argillaceus. (FEMS Microbiol Lett. , 2000)

close this sectionSequence

selected fasta
>UvrA-like protein [UV-repair protein]
MVSHEAEGAPGGEFIEVVGANTHNLRNVSVTIPKNRIVAFTGVSGSGKTSLAIDTIHAEA
QLRYLNGISPFFRQFISPKDRPQVDRIAGLGVTLAVDQRRLNRSPRSTLGSITGLNDFLG
LLFARMPALGPEAVEFPELRGLTSAYFDRYSMEGRCKKCAGLGYVVTPAEDRIVTRPDLP
LRAGAGEWFERANSGEYLALPALAERYGADLDRPWRELPEAFRHAVLHGTGDEAVSYKIV
SKQKKSGTETVIERSVPLKGAVFEVSRLYEAAASDSSKENYARFMRRQDCEGCAGSGFGD
VPRTLKVAGLTYPEIVRMPIEDLRDWVATVDATLTPMQREVAVNLLPDLGRRVRLMVELG
LGHLRVTRSAPSMSGGELQRARVTAQLNMDLTGIIFVLDEPSAGLHPADKHPLREILHAL
RDAGNTVLLVEHDPELIALADWVVDLGPGAGREGGTLVASVPTAELSDNPHSLTGAYLAG
RGPRVRRERRYDAAAAPRLGLVGIDVHNVRLDRVDIPLNSLTCITGVSGSGKSSLLHEAL
GASLAATLRGECPEAVASVEGAAAVGWVTVVNQDPIGRTPRSNPATYTKAFDLIRKLYAA
TPQAKSLGYGAGSFSFNSPGGRCEACQGYGRRQVDMHFMPDMWVECDVCEGRRFTPELLA
VTYHGKSVDEVLAMTVDEAAEFFPGPAPLAATLRATQQAGLGYLQLGQSGTELSGGEAQR
LKLANAILMGSGSRGRGLVILDEPVTGLHPSDVQRMVDAFDTLLAAGNSVVIAEHDLHVA
ACADWIIDMGPGAGERGGTVVGEGPPATVAAGPGVTARYLRPLVAD
selected fasta
>UvrA-like protein [UV-repair protein]
GTGGTGAGTCACGAGGCCGAGGGCGCACCGGGCGGCGAGTTCATCGAGGTCGTCGGAGCG
AACACGCACAATCTGCGGAACGTCAGCGTCACCATCCCGAAGAACAGGATCGTCGCCTTC
ACCGGTGTCAGCGGCAGCGGGAAGACGTCCCTCGCCATCGACACGATCCACGCCGAGGCC
CAACTGCGGTACCTCAACGGCATCTCGCCGTTCTTCCGGCAGTTCATCTCGCCCAAGGAC
CGCCCCCAGGTGGACCGGATCGCCGGGCTCGGAGTGACCCTCGCCGTGGATCAGCGGCGG
CTGAACCGCAGTCCCCGCTCGACCCTGGGCAGCATCACCGGACTGAACGACTTCCTCGGG
CTGCTGTTCGCGCGCATGCCCGCACTGGGCCCGGAAGCCGTGGAGTTCCCCGAGCTACGC
GGGCTCACCAGCGCCTACTTCGACCGCTACAGCATGGAGGGCCGCTGCAAGAAGTGCGCC
GGCCTCGGCTACGTCGTCACCCCGGCCGAGGACCGGATCGTCACCCGGCCCGACCTCCCG
CTGAGGGCCGGGGCGGGGGAGTGGTTCGAGCGGGCCAACTCCGGCGAGTACCTTGCGCTG
CCCGCACTCGCCGAGCGGTACGGTGCCGACCTCGACCGGCCCTGGCGCGAGCTGCCTGAG
GCGTTCCGCCACGCCGTGCTCCACGGCACGGGGGACGAGGCGGTCTCCTACAAGATCGTC
AGCAAGCAGAAGAAGTCCGGCACCGAGACCGTCATCGAACGCAGCGTCCCGCTCAAGGGT
GCTGTCTTCGAGGTCTCACGGCTGTACGAGGCCGCGGCCTCCGACAGCAGCAAGGAGAAC
TACGCGCGGTTCATGCGCCGTCAGGACTGCGAGGGCTGTGCGGGCAGCGGCTTCGGCGAC
GTCCCGCGCACCCTCAAGGTCGCCGGGCTGACCTACCCCGAGATCGTGCGGATGCCCATC
GAGGATCTGCGGGACTGGGTGGCGACCGTCGACGCCACCCTCACCCCCATGCAGCGCGAG
GTCGCGGTCAACCTGCTGCCCGACCTCGGCCGACGGGTCCGCCTGATGGTCGAGCTGGGA
CTGGGCCACCTGCGGGTCACCCGCAGTGCCCCGTCCATGTCCGGCGGTGAACTGCAGCGA
GCCCGCGTCACCGCCCAGCTGAACATGGACCTGACCGGCATCATCTTCGTCCTGGACGAG
CCGAGTGCCGGACTGCACCCCGCCGACAAGCATCCGTTGCGTGAGATCCTGCACGCGCTG
CGAGACGCGGGCAACACGGTCCTGCTCGTCGAGCACGACCCCGAACTCATCGCACTCGCC
GACTGGGTGGTGGACCTGGGGCCCGGCGCAGGACGCGAGGGCGGCACCCTCGTCGCATCC
GTGCCCACCGCCGAGCTCAGCGACAACCCGCACTCGCTCACCGGCGCCTACCTTGCGGGG
CGCGGCCCCCGGGTCCGGCGGGAGCGGCGCTACGACGCCGCGGCCGCGCCGCGGCTCGGC
CTGGTCGGGATCGACGTGCACAACGTCCGGCTGGACCGGGTGGACATCCCTCTCAACTCG
CTGACCTGTATCACCGGGGTGAGCGGCAGCGGCAAGAGCAGCCTCCTGCACGAGGCCCTC
GGTGCGAGCCTGGCGGCCACGCTGCGCGGTGAATGCCCCGAAGCCGTCGCCTCGGTCGAG
GGCGCGGCGGCGGTGGGCTGGGTGACCGTGGTGAACCAGGACCCGATCGGCCGTACCCCG
CGGTCCAACCCCGCCACCTACACCAAGGCCTTCGACCTGATCCGCAAGCTCTACGCGGCC
ACCCCCCAGGCCAAGAGCCTGGGCTACGGCGCCGGATCGTTCTCCTTCAACTCGCCCGGC
GGCCGCTGTGAGGCCTGCCAGGGGTACGGAAGGCGCCAGGTCGACATGCACTTCATGCCC
GACATGTGGGTCGAGTGCGATGTCTGCGAGGGCCGCCGGTTCACCCCCGAACTGCTCGCC
GTCACCTATCACGGCAAGTCGGTCGACGAGGTGCTGGCCATGACGGTGGACGAGGCCGCC
GAGTTCTTCCCCGGCCCCGCACCCCTCGCCGCCACCCTCCGCGCCACCCAGCAGGCGGGG
CTGGGCTACCTGCAACTCGGGCAGAGCGGAACCGAGTTGTCAGGCGGTGAGGCGCAGCGC
CTCAAGCTCGCCAACGCCATACTCATGGGCAGCGGCAGTCGGGGACGGGGCCTGGTGATC
CTCGATGAACCGGTCACCGGGCTCCATCCCTCCGACGTACAGCGCATGGTCGACGCCTTC
GACACCCTGCTCGCGGCCGGCAACTCCGTCGTCATCGCCGAGCACGATCTGCACGTCGCC
GCCTGCGCCGACTGGATCATCGACATGGGGCCGGGCGCCGGCGAACGGGGAGGCACGGTC
GTCGGCGAGGGCCCTCCGGCGACCGTCGCGGCCGGCCCGGGCGTCACGGCCCGGTACCTG
CGGCCTCTCGTGGCCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003439 ABC transporter-like (Domain)
 [576-745]  1.2e-06 PF00005
PF00005   ABC_tran
IPR003593 AAA+ ATPase domain (Domain)
 [34-448]  0.00210000037262656 SM00382 [518-793]  0.000139999968906909 SM00382
SM00382   AAA
IPR017871 ABC transporter, conserved site (Conserved_site)
 [713-727]  PS00211
PS00211   ABC_TRANSPORTER_1
SignalP No significant hit
TMHMM No significant hit