close all open/close all

CDS information : Chro_00260


close this sectionLocation

Organism
StrainATCC 13273 (=NBRC 3746)
Entry nameChromomycin
Contig
Start / Stop / Direction28,766 / 29,992 / + [in whole cluster]
28,766 / 29,992 / + [in contig]
Location28766..29992 [in whole cluster]
28766..29992 [in contig]
TypeCDS
Length1,227 bp (408 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-3 C-methyltransferase
Product (GenBank)NDP-C-methyltransferase
Gene
Gene (GenBank)cmmC
EC number2.1.1.-
Keyword
  • L-chromose
Note
Note (GenBank)
Reference
ACC
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
Related Reference
ACC
P96561
NITE
Chlor_00150
PmId
[11035791] Deoxysugars in glycopeptide antibiotics: enzymatic synthesis of TDP-L-epivancosamine in chloroeremomycin biosynthesis. (Proc Natl Acad Sci U S A. , 2000)

close this sectionSequence

selected fasta
>putative NDP-hexose C-3 C-methyltransferase [NDP-C-methyltransferase]
MSDTLDCRICGGTLHEFFDFGRQPLADAFVDPNHPAQEYFHRLAVAQCGSCTMVQLLEDV
PREHMFRTDYPYLSSGSSAMQDHFRATAGHFLDHELRDLDSFVVEFGSNDGIMLDTVARA
GRRHLGVEPCAGVAEAAAAKGIRVRNAFFEESTAAEIVATEGRANVIYAANTFSHISYVD
SVFRGVDILLDEDGIFVFEDPYMGDIVERTSFDQIYDEHFYFFTVRSVQNMAAFYGFELV
DVEHLPVHGGEIRYTLARSGSRTPSPEVARFLDREKILGLAERPTLESFATNIDLLREGL
RSLLVRCRDEGRSVVGYGATAKSATLTNYCGIGPELVSFIADNTPAKQGTLSPGSHIPVR
SPEAFADPYPDYALLFAWNHAEEIMRKEAEFKRRGGRWILYVPELHIV
selected fasta
>putative NDP-hexose C-3 C-methyltransferase [NDP-C-methyltransferase]
ATGTCTGACACGCTCGACTGCCGGATCTGCGGCGGTACGCTGCACGAGTTCTTCGACTTC
GGACGCCAGCCACTGGCTGACGCGTTCGTCGACCCGAACCACCCCGCCCAGGAGTACTTC
CACCGGCTAGCGGTTGCCCAGTGCGGCTCCTGCACGATGGTCCAGCTCCTGGAGGACGTA
CCGCGCGAGCACATGTTCCGCACCGACTACCCCTACCTCTCCTCGGGGTCCTCGGCCATG
CAGGACCACTTCCGCGCCACCGCCGGGCACTTCCTCGACCACGAACTGCGCGACCTGGAC
TCCTTCGTCGTCGAGTTCGGCAGCAACGACGGCATCATGCTCGACACCGTGGCCCGGGCC
GGCCGCCGCCACCTCGGCGTCGAGCCCTGCGCGGGCGTCGCCGAGGCCGCCGCCGCCAAG
GGCATCCGGGTCCGTAACGCCTTCTTCGAGGAATCCACGGCGGCCGAGATCGTCGCCACC
GAGGGCCGCGCGAACGTCATCTACGCCGCCAACACCTTCTCGCACATCTCCTACGTCGAC
TCCGTCTTCCGCGGGGTGGACATCCTGCTCGACGAGGACGGCATCTTCGTCTTTGAGGAC
CCCTACATGGGGGACATCGTCGAGCGGACGTCGTTCGACCAGATCTACGACGAGCACTTC
TACTTCTTCACCGTGCGGTCGGTGCAGAACATGGCGGCCTTCTACGGATTCGAACTCGTC
GACGTGGAGCACCTGCCCGTGCACGGCGGCGAGATCCGCTACACGCTCGCCCGGTCGGGC
TCACGGACGCCCTCCCCCGAGGTCGCCCGCTTCCTGGACCGGGAGAAGATCCTCGGACTC
GCCGAACGGCCCACGCTGGAGAGCTTCGCCACCAACATCGACCTGCTGCGCGAGGGGCTC
CGCTCGCTGCTGGTGCGCTGCCGTGACGAGGGCAGGAGCGTCGTCGGCTACGGGGCGACC
GCCAAGAGCGCCACGCTCACCAACTACTGCGGCATCGGCCCCGAACTGGTGTCCTTCATC
GCGGACAACACCCCGGCCAAGCAGGGCACACTCAGTCCCGGATCGCACATCCCGGTGCGC
TCGCCCGAGGCGTTCGCCGACCCCTACCCCGACTACGCGCTGCTGTTCGCCTGGAACCAC
GCCGAGGAGATCATGCGCAAGGAGGCCGAGTTCAAGCGCCGCGGCGGCCGGTGGATCCTC
TACGTGCCCGAACTCCACATCGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013630 Methyltransferase putative zinc binding domain (Domain)
 [7-67]  4.29999999999998e-21 PF08421
PF08421   Methyltransf_13
IPR013691 C-methyltransferase (Domain)
 [245-403]  4.80000000000003e-56 PF08484
PF08484   Methyltransf_14
SignalP No significant hit
TMHMM No significant hit