close all open/close all

CDS information : Chro_00270


close this sectionLocation

Organism
StrainATCC 13273 (=NBRC 3746)
Entry nameChromomycin
Contig
Start / Stop / Direction31,035 / 29,965 / - [in whole cluster]
31,035 / 29,965 / - [in contig]
Locationcomplement(29965..31035) [in whole cluster]
complement(29965..31035) [in contig]
TypeCDS
Length1,071 bp (356 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 ketoreductase
Product (GenBank)NDP-4-ketoreductase
Gene
Gene (GenBank)cmmUIII
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
Related Reference
ACC
Q2PC38
NITE
Rubra_00520
PmId
[16614891] Functional characterization of ketoreductase (rubN6) and aminotransferase (rubN4) genes in the gene cluster of Streptomyces achromogenes var. rubradiris. (Biotechnol Lett. , 2006)
ACC
Q9F834
NITE
Megalo_00080
PmId
[20418422] TDP-L-megosamine biosynthesis pathway elucidation and megalomicin a production in Escherichia coli. (Appl Environ Microbiol. , 2010)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 ketoreductase [NDP-4-ketoreductase]
MAGEKTEPLVVVLGAAGYLGSAVVAELARRPVRLRRVARPGRLREIPAAVWGDASSQASP
WAADLSRPGAVARAVAGADVIVHLVAHIGEASAWRAAEHDPAAARVNVEPAHDLVAALRA
RRGGGPPPVVLFAGSASQVGRAGVIDGSEPDEPVTVYARQKLAAEQALLAASAEGVLRGV
SLRLPTVYGAGPGPLGNGVVTAMARRAFAGEPLPVWSDGSVERDLLHVTDAARAFAVCAA
PDRAGALAGRHWVVGTGRPVRVADLFTAVARSVAAHTGAPPVPVVSVEPPATATAADVRG
TVVDASAFRTATAGAPGSRCRRRWTSWWRPSPGRGQSDDGPQDRGGVPQTMWSSGT
selected fasta
>putative NDP-hexose C-4 ketoreductase [NDP-4-ketoreductase]
GTGGCAGGGGAGAAGACGGAGCCGCTGGTCGTCGTCCTGGGCGCTGCCGGCTATCTGGGA
TCGGCCGTCGTGGCGGAGCTCGCCCGCCGGCCGGTCCGGCTGCGCCGGGTGGCCCGGCCC
GGCCGGCTGCGCGAGATCCCAGCGGCGGTCTGGGGGGACGCCTCGTCGCAGGCGTCGCCG
TGGGCGGCCGACCTGTCCCGGCCCGGGGCCGTCGCCCGGGCCGTGGCGGGCGCCGACGTG
ATCGTTCATCTCGTCGCGCACATCGGCGAGGCGTCGGCATGGCGGGCCGCCGAACACGAC
CCGGCCGCCGCGCGGGTGAACGTGGAGCCGGCACACGACCTGGTGGCCGCGCTCCGGGCG
AGGCGGGGCGGCGGGCCGCCACCGGTGGTGCTCTTCGCCGGTTCGGCCTCACAGGTGGGG
CGGGCGGGGGTGATCGACGGCAGCGAACCCGACGAGCCCGTAACGGTGTACGCACGCCAG
AAGCTCGCCGCTGAGCAGGCTCTCCTGGCCGCTTCGGCCGAGGGGGTGCTGCGCGGGGTG
TCGCTGCGGCTGCCCACGGTGTACGGGGCGGGGCCCGGGCCGCTCGGCAACGGGGTGGTC
ACCGCGATGGCGCGGCGCGCGTTCGCGGGCGAGCCGCTCCCGGTGTGGAGCGACGGGTCC
GTGGAACGGGACCTGCTGCATGTCACGGACGCGGCCCGCGCGTTCGCGGTGTGCGCGGCC
CCGGACCGGGCCGGCGCGCTGGCCGGACGTCACTGGGTGGTGGGCACCGGCCGGCCGGTG
CGGGTGGCCGATCTGTTCACCGCCGTCGCCCGGAGCGTCGCCGCGCACACCGGCGCGCCG
CCGGTGCCGGTGGTGTCCGTGGAGCCGCCGGCCACGGCGACGGCCGCCGACGTCCGGGGC
ACGGTCGTCGACGCCTCGGCCTTCCGGACCGCCACGGCTGGCGCCCCCGGCAGTCGATGC
CGGAGGCGCTGGACGAGCTGGTGGCGGCCCTCGCCCGGCAGAGGGCAGTCTGACGACGGG
CCCCAGGACCGTGGTGGGGTCCCTCAGACGATGTGGAGTTCGGGCACGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [10-255]  2.1e-38 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [10-234]  1.99999999999999e-35 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-25]  0.686 Signal
Eukaryota   
 [1-40]  0.264 Signal
Bacteria, Gram-positive   
TMHMM No significant hit