close all open/close all

CDS information : Chro_00280


close this sectionLocation

Organism
StrainATCC 13273 (=NBRC 3746)
Entry nameChromomycin
Contig
Start / Stop / Direction32,234 / 31,041 / - [in whole cluster]
32,234 / 31,041 / - [in contig]
Locationcomplement(31041..32234) [in whole cluster]
complement(31041..32234) [in contig]
TypeCDS
Length1,194 bp (397 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductD-olivose glycosyltransferase
Product (GenBank)glycosyltransferase
Gene
Gene (GenBank)cmmGIII
EC number
Keyword
  • trisaccharide 2nd D-olivose
Note
Note (GenBank)
Reference
ACC
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
[16391039] Deoxysugar transfer during chromomycin A3 biosynthesis in Streptomyces griseus subsp. griseus: new derivatives with antitumor activity. (Appl Environ Microbiol. , 2006)

close this sectionSequence

selected fasta
>D-olivose glycosyltransferase [glycosyltransferase]
MKVLFAASGWPTHYMAMVPLAWALRAAGHEVRVAAQPAMHATILRSGMPAVPVGSDVDYV
AVRKRTLSHERSDGAGHRDPAELRDAAERDEGGLFGAWNEATSAALDDTVAFARAWRPDL
VVGDTMAPAALVAAHVLGVPGVRHLWGPDILGTPEGAKILDILPGYREQYERHGVSAPGD
PAHRTVSPCPPSLQQPGLPERLSLRWVPYNGPGTTPGWLGVPPPRPRVCVTWGTSTTDVL
GHEDRTVPDVLEALAGLDVEVVVTVTAAERERLGPSAPGVRVLESMPLHLLMPGCDLLVH
QGGFMTALTAAHHGVPQLLVPQLPNQVSDAQVLEGAGVARRLPAEEAGVGSLRAAVEEVL
GGRAYRVAAARLRTEILAQPSPADVAADLAELARTGP
selected fasta
>D-olivose glycosyltransferase [glycosyltransferase]
ATGAAGGTCCTCTTCGCGGCCTCGGGCTGGCCCACGCACTACATGGCGATGGTCCCGCTC
GCCTGGGCGCTGCGTGCGGCGGGCCACGAGGTCCGGGTGGCGGCCCAGCCCGCCATGCAC
GCCACGATCCTGCGCTCGGGCATGCCGGCGGTGCCGGTGGGTTCCGACGTGGACTACGTC
GCGGTACGCAAACGGACCCTGTCCCACGAGCGGTCGGACGGAGCCGGTCACCGCGACCCG
GCGGAGCTGCGCGATGCGGCGGAGCGGGACGAAGGCGGTCTGTTCGGCGCCTGGAACGAG
GCGACGTCGGCCGCTCTGGACGACACAGTCGCCTTCGCCCGCGCATGGCGGCCTGATCTC
GTCGTCGGCGACACGATGGCGCCCGCGGCACTCGTCGCAGCCCATGTGCTGGGGGTGCCG
GGGGTGCGGCACCTGTGGGGACCGGACATCCTGGGCACCCCGGAGGGGGCGAAGATCCTC
GACATCCTTCCGGGTTACCGGGAGCAGTACGAGCGGCACGGTGTCAGCGCCCCGGGGGAC
CCGGCCCACCGCACTGTCTCCCCCTGTCCGCCGAGTCTTCAGCAGCCCGGGCTGCCCGAA
AGGCTGTCCCTGCGGTGGGTGCCGTACAACGGCCCGGGGACCACGCCCGGCTGGCTCGGC
GTCCCGCCGCCCAGGCCGCGGGTGTGCGTCACCTGGGGAACCTCCACGACGGACGTGCTC
GGGCACGAGGACCGGACTGTGCCCGATGTGCTCGAGGCTCTGGCCGGTCTCGACGTCGAG
GTCGTCGTCACGGTGACGGCGGCGGAACGCGAGCGGCTCGGGCCATCGGCGCCCGGTGTG
CGGGTGCTGGAGTCCATGCCGCTGCATCTCCTGATGCCGGGGTGCGACCTGCTGGTCCAC
CAAGGAGGATTCATGACGGCTCTGACGGCCGCCCACCACGGGGTGCCGCAGCTCCTCGTC
CCGCAACTGCCCAACCAGGTCTCCGACGCACAGGTACTGGAGGGGGCGGGGGTGGCGCGC
CGGCTGCCGGCCGAGGAGGCGGGCGTCGGCTCCCTGCGTGCGGCGGTCGAGGAGGTCTTG
GGCGGGCGGGCGTACCGGGTGGCTGCGGCCCGGCTGCGCACCGAGATCCTCGCCCAGCCC
AGCCCGGCGGACGTGGCCGCAGACCTCGCCGAGCTGGCCAGGACCGGGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-148]  1.5e-13 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [186-281]  7.09999999999999e-26 PF06722
PF06722   DUF1205
SignalP
 [1-23]  0.473 Signal
Bacteria, Gram-negative   
 [1-34]  0.364 Signal
Bacteria, Gram-positive   
 [1-28]  0.965 Signal
Eukaryota   
TMHMM No significant hit