close all open/close all

CDS information : Chro_00290


close this sectionLocation

Organism
StrainATCC 13273 (=NBRC 3746)
Entry nameChromomycin
Contig
Start / Stop / Direction33,508 / 32,240 / - [in whole cluster]
33,508 / 32,240 / - [in contig]
Locationcomplement(32240..33508) [in whole cluster]
complement(32240..33508) [in contig]
TypeCDS
Length1,269 bp (422 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Producthexose O-acetyltransferase
Product (GenBank)acetyltransferase
Gene
Gene (GenBank)cmmA
EC number2.3.1.-
Keyword
  • trisaccharide 3rd L-chromose
  • disaccharide 1st D-oliose
Note
Note (GenBank)
Reference
ACC
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
[15255901] Tailoring modification of deoxysugars during biosynthesis of the antitumour drug chromomycin A by Streptomyces griseus ssp. griseus. (Mol Microbiol. , 2004)
[21342468] The chromomycin CmmA acetyltransferase: a membrane-bound enzyme as a tool for increasing structural diversity of the antitumour mithramycin. (Microb Biotechnol. , 2011)

close this sectionSequence

selected fasta
>hexose O-acetyltransferase [acetyltransferase]
MISPVVENTAKNNAAVTHLVSLTGLRGILALMVFGTHFFLAFVMAGGSMDSPFVQQVFHV
LFSRAGGTAVSCFFLLSGFVLAYIARPGDSTRSFYRRRIAKIYPVHLISTAVAFILVSVR
YEVPGMEVTLSHVFLVQSWVPSQWYYLTMTGIDWSLSCEAFFYLCFPVLLPVLSRARNGM
LYAVSACSVFLVFFLPYVVGHTFAIRSPDPVEMVPTAGYGGPIGYWFAYVFPPMRMAEFV
IGISLAVLVRRGAWRGPGVAACLVLCAIGWGVNLHLDSYLPLAAGMLIPFALLIPALSTA
DVNSAWSPLRWKPLVWFGEISLSFYVSHLLVQEELFSRLWNLGMRAGLLPAPLPVLSWWV
AVLSFLAQFALAVLAAWLLHRLVEQPLVRRLRPKDVPPVPVTSPQSSAPPAHQAGAAHMV
ER
selected fasta
>hexose O-acetyltransferase [acetyltransferase]
ATGATTTCCCCGGTTGTCGAGAATACAGCCAAGAATAATGCGGCGGTCACCCATCTCGTG
TCCCTCACAGGACTGCGCGGAATTCTCGCGTTGATGGTGTTCGGCACGCATTTCTTTCTC
GCGTTCGTCATGGCGGGCGGGTCGATGGACTCGCCGTTCGTACAGCAGGTGTTCCACGTG
CTGTTCTCCCGGGCCGGCGGAACGGCGGTCTCCTGCTTCTTCCTGCTCAGCGGGTTCGTC
CTGGCCTACATCGCACGCCCGGGTGACAGCACCCGCTCCTTCTACCGGCGCCGGATCGCG
AAGATCTATCCGGTCCACCTGATCAGCACCGCCGTCGCGTTCATCCTGGTCTCGGTGCGG
TACGAGGTGCCCGGCATGGAGGTCACGCTGTCCCATGTGTTCCTGGTGCAGAGCTGGGTC
CCGAGCCAGTGGTACTACCTCACGATGACGGGCATCGACTGGTCGCTGAGCTGTGAGGCG
TTCTTCTACCTGTGCTTCCCCGTACTGCTTCCGGTGCTGAGCAGGGCCAGGAACGGGATG
CTCTACGCGGTGTCCGCGTGCTCGGTGTTCCTGGTCTTCTTCCTGCCGTACGTCGTCGGA
CACACCTTCGCGATCCGCTCGCCCGATCCGGTGGAGATGGTGCCGACCGCCGGATACGGC
GGGCCGATCGGCTACTGGTTCGCGTATGTCTTCCCGCCCATGCGCATGGCCGAGTTCGTC
ATCGGGATCTCCCTGGCCGTCCTGGTGCGCAGGGGCGCGTGGCGCGGACCGGGGGTCGCG
GCCTGCCTGGTGCTGTGCGCGATCGGCTGGGGGGTCAATCTCCACCTCGACAGCTATCTG
CCGCTCGCGGCGGGCATGCTCATCCCCTTCGCCCTGCTCATCCCCGCCCTCAGCACCGCC
GACGTCAACTCCGCCTGGTCGCCGCTCCGCTGGAAACCGCTGGTGTGGTTCGGCGAGATA
TCCCTGTCCTTCTACGTCAGCCATCTGCTGGTCCAGGAGGAGCTGTTCAGCCGGCTGTGG
AACCTCGGCATGCGGGCGGGTCTGCTGCCCGCGCCGCTGCCCGTGCTGTCCTGGTGGGTG
GCGGTGCTGTCGTTCCTCGCCCAGTTCGCGCTGGCTGTGCTGGCCGCCTGGCTGCTCCAC
CGGCTGGTGGAACAGCCGCTGGTGCGCAGGCTGCGGCCGAAGGACGTCCCCCCGGTTCCG
GTGACCTCGCCCCAGTCGTCGGCCCCTCCCGCACATCAGGCCGGTGCGGCACACATGGTG
GAGAGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002656 Acyltransferase 3 (Domain)
 [20-376]  2.5e-26 PF01757
PF01757   Acyl_transf_3
SignalP
 [1-45]  0.348 Signal
Eukaryota   
TMHMM
 [23-45]  Transmembrane (i-o) [60-82]  Transmembrane (o-i) [102-124]  Transmembrane (i-o) [152-174]  Transmembrane (o-i) [181-203]  Transmembrane (i-o) [223-245]  Transmembrane (o-i) [252-274]  Transmembrane (i-o) [278-300]  Transmembrane (o-i) [313-332]  Transmembrane (i-o) [358-380]  Transmembrane (o-i)
Transmembrane 10