close all open/close all

CDS information : Chro_00300


close this sectionLocation

Organism
StrainATCC 13273 (=NBRC 3746)
Entry nameChromomycin
Contig
Start / Stop / Direction34,770 / 33,505 / - [in whole cluster]
34,770 / 33,505 / - [in contig]
Locationcomplement(33505..34770) [in whole cluster]
complement(33505..34770) [in contig]
TypeCDS
Length1,266 bp (421 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglycosyltransferase
Product (GenBank)glycosyltransferase
Gene
Gene (GenBank)cmmGIV
EC number
Keyword
  • trisaccharide 1st D-olivose
  • (trisaccharide 3rd sugar)
Note
Note (GenBank)
Reference
ACC
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
[16391039] Deoxysugar transfer during chromomycin A3 biosynthesis in Streptomyces griseus subsp. griseus: new derivatives with antitumor activity. (Appl Environ Microbiol. , 2006)
Related Reference
ACC
Q194Q0
NITE
Mith_00250
PmId
[10660060] Characterization of two glycosyltransferases involved in early glycosylation steps during biosynthesis of the antitumor polyketide mithramycin by Streptomyces argillaceus. (Mol Gen Genet. , 2000)
[22997042] Cooperation of two bifunctional enzymes in the biosynthesis and attachment of deoxysugars of the antitumor antibiotic mithramycin. (Angew Chem Int Ed Engl. , 2012)

close this sectionSequence

selected fasta
>glycosyltransferase [glycosyltransferase]
MRLLFTAFPSPSHLFPMVPLAWAARAAGHEVRVAGAPSLVDAITASGLPAVPVGAEVDLT
GTSRGGSLSGWHDHERWPAGWPVTPSLLDGRRKELLEALGQRQFAIAAGMLDDLVRFGEA
WRPDAVVHDAVSYAGPVAGSVLDIPSVSHLWGSPGLQRLEMKGLGPDPQDGFVALFDRYR
AAVRTWPDAWVDPCPPSMGFGSGPDVHSVQYVPYNGPGRIPVRLLDPPSRPRVCVTWGAT
TAKLLGADMTELLRQAVEAVAALPVEVVLATTADQRQLLGDLPPSVRTEISVPLHMLLPG
CVAVVHHGGAGTTLTAARHGVPQLTITRRPEPTLNGERQALTGAGINLTYGEVSRTERPV
ETVREQVTRLLDDRSYRDAAGRLSAEILAQPSPADLVGVIEKLACFSTVSPRSSHRTKEA
G
selected fasta
>glycosyltransferase [glycosyltransferase]
ATGCGCCTGCTCTTCACTGCTTTCCCTTCACCGTCCCACCTTTTCCCCATGGTTCCGCTC
GCGTGGGCGGCGCGCGCGGCGGGCCACGAGGTGCGCGTCGCCGGCGCGCCCTCGCTCGTG
GACGCCATCACCGCCTCCGGGCTGCCGGCCGTGCCGGTCGGTGCCGAGGTCGATCTCACC
GGCACCTCCCGCGGCGGGAGCCTCTCCGGCTGGCACGACCACGAGCGGTGGCCGGCCGGT
TGGCCGGTGACCCCCAGCCTGCTCGACGGCCGGCGCAAGGAACTACTGGAAGCCCTGGGG
CAGCGGCAGTTCGCGATAGCCGCCGGGATGCTCGATGACCTGGTGCGGTTCGGTGAGGCC
TGGCGGCCCGATGCCGTCGTCCACGACGCCGTCTCCTACGCGGGGCCGGTGGCCGGCTCG
GTCCTCGACATCCCCAGCGTGAGCCATCTGTGGGGTAGCCCGGGGCTTCAGCGCCTGGAG
ATGAAGGGGCTGGGTCCGGATCCCCAGGACGGTTTCGTCGCGCTCTTCGACCGGTACCGT
GCGGCGGTGCGGACCTGGCCCGACGCATGGGTTGACCCATGCCCGCCCAGCATGGGCTTC
GGTTCCGGGCCGGATGTGCACTCGGTGCAGTACGTGCCCTACAACGGCCCGGGACGGATC
CCCGTACGGCTCCTCGATCCGCCGTCCCGGCCGCGGGTCTGTGTCACCTGGGGCGCGACC
ACGGCCAAGCTGCTCGGCGCCGACATGACGGAGCTGCTGCGCCAGGCCGTGGAGGCCGTC
GCGGCCCTGCCCGTGGAGGTCGTCCTGGCCACCACCGCCGACCAGCGCCAACTGCTGGGC
GACCTACCGCCGTCCGTGCGTACCGAGATCTCCGTGCCGCTGCACATGCTGCTGCCGGGC
TGCGTAGCGGTGGTCCACCACGGCGGCGCGGGAACCACGCTCACCGCCGCCCGTCACGGC
GTCCCCCAGCTGACGATCACCCGCAGGCCCGAGCCGACGCTCAACGGCGAGCGGCAGGCC
CTCACCGGTGCGGGCATCAACCTGACGTACGGCGAGGTGAGCCGGACCGAGCGGCCGGTC
GAGACCGTACGGGAACAGGTGACCCGGCTACTGGACGACCGCTCCTACCGGGACGCGGCC
GGGCGGCTCTCAGCGGAAATCCTCGCCCAGCCCAGCCCGGCCGACCTGGTCGGCGTCATC
GAGAAACTGGCCTGCTTCTCCACTGTTTCCCCAAGGAGTTCCCACCGGACGAAAGAGGCA
GGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [4-150]  1.8e-14 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [191-287]  1.3e-26 PF06722
PF06722   DUF1205
SignalP
 [1-23]  0.726 Signal
Bacteria, Gram-negative   
 [1-23]  0.716 Signal
Bacteria, Gram-positive   
 [1-28]  0.989 Signal
Eukaryota   
TMHMM No significant hit