close all open/close all

CDS information : Chro_00310


close this sectionLocation

Organism
StrainATCC 13273 (=NBRC 3746)
Entry nameChromomycin
Contig
Start / Stop / Direction34,919 / 36,109 / + [in whole cluster]
34,919 / 36,109 / + [in contig]
Location34919..36109 [in whole cluster]
34919..36109 [in contig]
TypeCDS
Length1,191 bp (396 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductD-oliose glycosyltransferase
Product (GenBank)glycosyltransferase
Gene
Gene (GenBank)cmmGII
EC number
Keyword
  • disaccharide 1st D-oliose
Note
Note (GenBank)
Reference
ACC
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
[16391039] Deoxysugar transfer during chromomycin A3 biosynthesis in Streptomyces griseus subsp. griseus: new derivatives with antitumor activity. (Appl Environ Microbiol. , 2006)

close this sectionSequence

selected fasta
>D-oliose glycosyltransferase [glycosyltransferase]
MRVLLTSAPMHGHILQLVPLSWALKAAGHEVLLTVPEGSVEVALAAGLPAVGNAEPVAMS
EMIGRRRDGTPVPWPVSPEAKVRRSGRGFGRLAVRVIEGTLGIAERWRPDLVVSEPTEYA
GRMVAARLGVPWVEHGWGLHPSPLYAEAAAAELAPELAAWRLPALPEPRLVLDVCSPRMQ
RPDPRAVPVRRMRYVPYNGSAPVPPWALRPAARPRVCVTLGSVPAAGVPGLWAEVLTAMD
RMDADVVLATDPAQDLGPLPPTVRAVDWLPLTHVLPSCDLVVHHGGPGTTMTSLVHGLPQ
LVLAPLASDMATYGRRVVESGAGSTLPASGATAARIETECRRLLEDPRHRLGARALAEDI
AQQPSPALTVPSLVRVAHGDAPAAAEPEGEVRRCAG
selected fasta
>D-oliose glycosyltransferase [glycosyltransferase]
ATGAGGGTTTTGCTGACCAGCGCACCTATGCACGGGCACATCCTGCAACTCGTCCCGCTT
TCCTGGGCATTGAAGGCGGCAGGGCACGAGGTGCTGCTCACCGTGCCCGAGGGATCCGTC
GAGGTGGCGCTCGCGGCGGGGCTGCCCGCCGTGGGGAACGCCGAGCCGGTGGCGATGAGC
GAGATGATCGGACGACGGCGGGACGGCACCCCCGTCCCGTGGCCGGTCTCACCCGAAGCG
AAGGTGCGCCGCAGCGGACGCGGATTCGGCAGGCTGGCCGTGCGCGTCATCGAGGGAACC
TTGGGGATCGCCGAGCGGTGGCGGCCGGACCTGGTGGTCAGCGAGCCCACCGAGTACGCG
GGCCGGATGGTCGCCGCCCGTCTCGGTGTGCCCTGGGTGGAGCACGGCTGGGGTCTGCAC
CCTTCCCCGCTCTACGCGGAGGCCGCGGCCGCCGAGCTGGCGCCCGAACTGGCCGCCTGG
CGCCTGCCGGCGCTGCCGGAGCCCCGGCTGGTCCTCGACGTCTGTTCGCCGCGTATGCAG
CGTCCGGACCCGAGGGCCGTGCCCGTCCGGCGTATGCGGTACGTGCCGTACAACGGCTCG
GCGCCCGTACCGCCCTGGGCACTGCGGCCGGCTGCCCGGCCACGGGTGTGCGTCACGCTG
GGCAGCGTGCCAGCCGCCGGGGTGCCGGGGCTGTGGGCCGAGGTCCTGACCGCGATGGAC
CGGATGGACGCCGACGTGGTGCTCGCGACGGACCCCGCCCAGGACCTCGGTCCTCTGCCG
CCGACGGTACGGGCCGTCGACTGGCTGCCGCTGACCCATGTGCTGCCCTCCTGCGACCTG
GTCGTGCATCACGGCGGCCCCGGAACGACCATGACGTCGCTCGTCCACGGACTGCCGCAA
CTCGTCCTGGCGCCCCTCGCGTCGGACATGGCCACCTACGGCCGGCGGGTCGTCGAGTCC
GGCGCGGGGAGCACGCTGCCCGCGTCCGGGGCCACCGCCGCCCGGATCGAGACGGAGTGC
CGACGGTTGCTGGAGGATCCCCGCCACCGGTTGGGCGCCCGGGCCCTCGCCGAGGACATC
GCACAGCAGCCGTCCCCGGCCCTGACGGTCCCCTCCCTGGTGCGTGTCGCGCACGGCGAT
GCGCCAGCCGCCGCCGAGCCGGAAGGTGAGGTGCGGCGATGCGCCGGTTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-133]  2.2e-09 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [172-264]  2.1e-20 PF06722
PF06722   DUF1205
SignalP
 [1-28]  0.85 Signal
Eukaryota   
TMHMM No significant hit