close all open/close all

CDS information : Chro_00320


close this sectionLocation

Organism
StrainATCC 13273 (=NBRC 3746)
Entry nameChromomycin
Contig
Start / Stop / Direction36,097 / 36,726 / + [in whole cluster]
36,097 / 36,726 / + [in contig]
Location36097..36726 [in whole cluster]
36097..36726 [in contig]
TypeCDS
Length630 bp (209 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose epimerase
Product (GenBank)NDP-5-epimerase
Gene
Gene (GenBank)cmmF
EC number5.1.3.-
Keyword
  • L-chromose
Note
Note (GenBank)
Reference
ACC
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
Related Reference
ACC
O06330
PmId
[16472764] rmlB and rmlC genes are essential for growth of mycobacteria. (Biochem Biophys Res Commun. , 2006)
ACC
Q93EK2
PmId
[11544225] Rhamnose biosynthesis pathway supplies precursors for primary and secondary metabolism in Saccharopolyspora spinosa. (J Bacteriol. , 2001)
ACC
Q9L9E5
PmId
[16514445] Characterisation of Streptomyces spheroides NovW and revision of its functional assignment to a dTDP-6-deoxy-D-xylo-4-hexulose 3-epimerase. (Chem Commun (Camb). , 2006)
ACC
Q331R1
PmId
[15049360] Cloning, expression, and biological function of a dTDP-deoxyglucose epimerase (gerF) gene from Streptomyces sp. GERI-155. (Biotechnol Lett. , 2004)
[17053005] Biosynthesis of dTDP-6-deoxy-beta-D-allose, biochemical characterization of dTDP-4-keto-6-deoxyglucose reductase (GerKI) from Streptomyces sp. KCTC 0041BP. (Glycobiology. , 2007)

close this sectionSequence

selected fasta
>putative NDP-hexose epimerase [NDP-5-epimerase]
MRRLAVDGAWEIDLRPHHDERGTFVEWYSDDELAAALGAPMPVALGAVSISRKGVVRGVH
FVETPPGQARYVTCVAGEVRDFVVDVREGSPTFGRWDSVRLGPDQWRAVHLAEGLGHAFT
ALTDRATVLYLCSAPYRPGRERTIHPLDPELALPWPAGAERSLSIRDREAPTLAEARRRG
LLPAWSATPPRFTAATPAGPLPRPAPPTA
selected fasta
>putative NDP-hexose epimerase [NDP-5-epimerase]
ATGCGCCGGTTAGCCGTCGACGGCGCGTGGGAGATCGACCTCCGCCCGCACCACGACGAA
CGCGGCACCTTCGTCGAGTGGTACTCCGACGACGAGCTCGCGGCGGCTCTCGGGGCGCCG
ATGCCTGTGGCCCTGGGTGCTGTGTCGATCTCCCGCAAGGGCGTGGTCCGCGGTGTCCAC
TTCGTCGAGACGCCTCCGGGCCAGGCCCGCTACGTCACGTGTGTGGCGGGCGAGGTGCGG
GACTTCGTGGTGGACGTACGCGAGGGCTCACCCACCTTCGGCCGGTGGGACTCGGTGCGG
CTCGGGCCCGACCAATGGCGGGCCGTCCACCTCGCCGAGGGGCTGGGGCACGCCTTCACG
GCCCTTACCGACCGCGCCACCGTGCTCTACCTCTGCTCCGCCCCCTACCGGCCCGGACGC
GAACGGACGATCCACCCGCTAGACCCCGAGCTGGCCCTGCCCTGGCCCGCCGGCGCGGAG
CGGTCGCTCTCCATACGGGACCGGGAGGCCCCGACCCTCGCGGAGGCCCGGCGCCGCGGC
CTGCTCCCCGCCTGGTCCGCCACCCCGCCCCGGTTCACGGCGGCCACACCCGCCGGCCCG
CTGCCCCGGCCCGCCCCGCCGACTGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000888 dTDP-4-dehydrorhamnose 3,5-epimerase-related (Family)
 [2-180]  PD001462
PD001462   dTDP_sugar_isom
 [2-175]  1.09999999999999e-53 PF00908
PF00908   dTDP_sugar_isom
IPR011051 RmlC-like cupin domain (Domain)
 [1-180]  2.60000517657733e-64 SSF51182
SSF51182   RmlC_like_cupin
IPR014710 RmlC-like jelly roll fold (Domain)
 [2-185]  3.89999999999997e-57 G3DSA:2.60.120.10
G3DSA:2.60.120.10   RmlC-like_jellyroll
SignalP No significant hit
TMHMM No significant hit