close all open/close all

CDS information : Chro_00340


close this sectionLocation

Organism
StrainATCC 13273 (=NBRC 3746)
Entry nameChromomycin
Contig
Start / Stop / Direction38,437 / 39,198 / + [in whole cluster]
38,437 / 39,198 / + [in contig]
Location38437..39198 [in whole cluster]
38437..39198 [in contig]
TypeCDS
Length762 bp (253 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)ketoreductase
Gene
Gene (GenBank)cmmTII
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
Related Reference
ACC
P0AEK2
PmId
[1556094] The gene encoding Escherichia coli acyl carrier protein lies within a cluster of fatty acid biosynthetic genes. (J Biol Chem. , 1992)
[11669613] Structure of beta-ketoacyl-[acyl carrier protein] reductase from Escherichia coli: negative cooperativity and its structural basis. (Biochemistry. , 2001)

close this sectionSequence

selected fasta
>putative oxidoreductase [ketoreductase]
MDLGIAGKTALITGASSGIGTATARALAAEGARVVLTYRTGERRARELADELGADRDLAC
AVPYDLGDPSSVDAAVRAAENRWGGVDILVANAVRRGPRQPPGTHIEDVPAQQWRQLLRD
NLEQTLRTVQLVLPGMRARTWGRVALLSSHRTRDGAPGQEFYAAGKAALHGFARSLAWDA
GPDGVFVNLVSPGLTRTVGVLSDLPAEVRERELQRTPSGRLSTPEDVAAAIAFLCAEANG
NINGAVIDVSGGR
selected fasta
>putative oxidoreductase [ketoreductase]
ATGGACTTGGGAATCGCCGGAAAGACCGCGCTGATCACCGGCGCCTCATCGGGCATCGGT
ACGGCCACCGCCCGCGCGCTGGCCGCCGAGGGCGCCCGGGTGGTCCTCACCTACCGCACA
GGGGAGAGGCGGGCCCGCGAACTCGCGGACGAGCTGGGCGCGGACCGCGATCTGGCCTGT
GCCGTCCCGTACGACCTGGGCGACCCCTCGTCCGTCGACGCCGCCGTCCGGGCCGCCGAG
AACCGTTGGGGAGGTGTGGACATCCTCGTCGCCAACGCGGTGCGGCGCGGCCCCCGGCAA
CCGCCCGGCACCCACATCGAGGACGTCCCCGCACAGCAGTGGCGGCAACTTCTCCGGGAC
AACCTGGAACAGACCCTGCGCACGGTCCAGCTGGTCCTGCCCGGCATGCGCGCCCGTACC
TGGGGCCGGGTGGCGCTGCTGTCCTCGCACCGCACCCGCGACGGGGCACCGGGGCAGGAG
TTCTACGCCGCCGGCAAGGCCGCCCTGCACGGCTTCGCGCGCAGCCTGGCCTGGGACGCG
GGGCCCGACGGTGTCTTCGTCAACCTCGTCAGCCCGGGCCTGACCCGCACCGTGGGAGTG
CTGTCCGACCTGCCGGCGGAGGTACGCGAGCGGGAGCTGCAGCGCACCCCGAGCGGGCGG
CTGAGCACACCCGAGGACGTGGCGGCGGCGATCGCGTTCCTCTGCGCCGAGGCGAACGGC
AACATCAACGGCGCCGTGATCGACGTCTCGGGCGGCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [8-177]  5.90000000000001e-31 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [9-26]  3.39999972437717e-31 PR00081 [84-95]  3.39999972437717e-31 PR00081 [136-152]  3.39999972437717e-31 PR00081 [162-181]  3.39999972437717e-31 PR00081 [183-200]  3.39999972437717e-31 PR00081 [217-237]  3.39999972437717e-31 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [6-252]  2.09999999999996e-71 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [149-177]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-28]  0.978 Signal
Bacteria, Gram-negative   
 [1-28]  0.983 Signal
Bacteria, Gram-positive   
TMHMM No significant hit