close all open/close all

CDS information : Chro_00350


close this sectionLocation

Organism
StrainATCC 13273 (=NBRC 3746)
Entry nameChromomycin
Contig
Start / Stop / Direction39,332 / 40,288 / + [in whole cluster]
39,332 / 40,288 / + [in contig]
Location39332..40288 [in whole cluster]
39332..40288 [in contig]
TypeCDS
Length957 bp (318 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase/dehydratase
Product (GenBank)aromatase
Gene
Gene (GenBank)cmmQ
EC number
Keyword
  • 1st ring
Note
Note (GenBank)
Reference
ACC
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
Related Reference
ACC
Q2PA00
NITE
Stref_00150
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)
ACC
Q54221
NITE
Griseu_00050
PmId
[8169211] Cloning, sequencing, and analysis of the griseusin polyketide synthase gene cluster from Streptomyces griseus. (J Bacteriol. , 1994)
[9195917] Domain analysis of the molecular recognition features of aromatic polyketide synthase subunits. (J Biol Chem. , 1997)
[10467128] Heterologous expression, purification, reconstitution and kinetic analysis of an extended type II polyketide synthase. (Chem Biol. , 1999)

close this sectionSequence

selected fasta
>putative cyclase/dehydratase [aromatase]
MSQPHLIRHRVTVRAAAPLCFGLMADLDHWPQHFGPAVHAEVLEPDEGDGDLIRRWALTG
GTGVHVWDARRRLDRNGLRIVFDQVEPQAPLTGMRAVWSFEADGEGITTVGVTHEFTVTG
DDPEAVRRTTDDVNARTPDQLDSLRDLAERWDEVEPLVISFEDPLFIGGRLEDVYEFLYA
ADAWPERVPHVEKLEMTEDTPGIQFFDMHTHTPDGRDHSTRSVRVCLPSHKIVYKQISLP
ALLDGHTGHWVFTETPEGVIAHARHTATIKPSALPLLGEGTTVADARKYLRRVLSTNSLQ
TLRYAKQFAEERVHAAHA
selected fasta
>putative cyclase/dehydratase [aromatase]
ATGTCCCAGCCGCACCTCATCCGGCACCGCGTCACCGTCCGAGCAGCCGCCCCGCTCTGC
TTCGGCCTGATGGCCGACCTCGACCACTGGCCCCAGCACTTCGGTCCCGCCGTGCACGCC
GAGGTCCTGGAGCCCGACGAAGGCGACGGCGACCTGATCCGTCGCTGGGCGCTGACCGGC
GGCACCGGCGTGCACGTCTGGGACGCCCGCCGCCGGCTCGACCGGAACGGCCTGCGCATC
GTCTTCGACCAGGTGGAGCCGCAGGCACCCCTGACCGGCATGCGCGCCGTGTGGAGCTTC
GAGGCCGACGGCGAGGGAATCACGACCGTGGGCGTCACCCATGAGTTCACCGTCACCGGG
GACGATCCCGAAGCGGTGCGTCGGACCACCGACGACGTCAACGCCCGCACCCCCGACCAG
CTCGACTCGCTGCGTGACCTTGCCGAGCGGTGGGACGAGGTGGAGCCCCTGGTCATCTCC
TTCGAGGACCCGCTGTTCATCGGCGGCCGGCTGGAGGACGTCTACGAGTTCCTGTACGCA
GCCGACGCATGGCCGGAGCGTGTTCCGCACGTGGAGAAGCTGGAGATGACCGAGGACACC
CCCGGCATCCAGTTCTTCGACATGCACACGCACACCCCCGACGGACGCGACCACAGCACC
CGGTCCGTGCGGGTCTGCCTGCCGAGCCACAAGATCGTCTACAAGCAGATCAGTCTTCCG
GCCCTGCTCGACGGCCATACCGGGCACTGGGTGTTCACGGAGACCCCGGAGGGTGTCATC
GCCCACGCCCGGCACACCGCGACGATCAAACCGTCCGCGCTGCCACTCCTGGGGGAGGGC
ACCACGGTCGCCGACGCCCGGAAGTACCTGCGCCGGGTCCTGAGTACCAACAGCCTGCAA
ACCCTGCGGTACGCCAAGCAGTTCGCCGAGGAGCGAGTCCATGCCGCCCACGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR023393 START-like domain (Domain)
 [8-150]  4.9e-08 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP
 [1-40]  0.662 Signal
Eukaryota   
TMHMM No significant hit