close all open/close all
Chro_00350 Chro_00350   last last

CDS information : Chro_00360


close this sectionLocation

Organism
StrainATCC 13273 (=NBRC 3746)
Entry nameChromomycin
Contig
Start / Stop / Direction40,362 / 41,948 / + [in whole cluster]
40,362 / 41,948 / + [in contig]
Location40362..41948 [in whole cluster]
40362..41948 [in contig]
TypeCDS
Length1,587 bp (528 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative ligase
Product (GenBank)acyl CoA ligase
Gene
Gene (GenBank)cmmLII
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
Related Reference
ACC
P41636
PmId
[9008388] Molecular cloning of 4-coumarate:coenzyme A ligase in loblolly pine and the roles of this enzyme in the biosynthesis of lignin in compression wood. (Plant Physiol. , 1997)

close this sectionSequence

selected fasta
>putative ligase [acyl CoA ligase]
MPFDLARVPEVPLDGLLRRAAAAAPDRVAVRTPTGTTTYAELDGRADDCARSLSRAAGGS
GTAVGLVASLDPSFAVAYYGAVRADHVVVLINPHLRGDALAHVLSVAGTTVVVAPPEFAE
RVAQVRGKLPHLRDVLSPDVLVQGRAGPGGRGRDAPGSAPHLDSVACVQFTSGTTGEPKA
VQLTHRNLVVNAAQIASVHGLDGDAVTLNNLPLYHPMHLNAAVYAGATQVLCPSPDPAEA
IEAANRHRATHYYSLPVRLAHLAADPRLPGLRLETVRAVFSGGSALLPAQARTLGTHFGI
PVVQGYGLAETSPLTHGEPPARPRPGSVGPEVPGTECRVVDMDRRTPLPAGRDGEIQVRG
PQLMRGYLGAAGPAVDADGWFSTGDIGHRDQDGYLYLVDRIKDVFKYENWLVSPTEIEQV
LITHPAVRDCAVVDHPEPFSGAVAHAFVVLDEDAALPGPAELAAHVNDQVPYYQQIKYLD
VVERVPRSPNGKILRRELRARAAHTDRADRLHPGAAGRPHSDLIGENP
selected fasta
>putative ligase [acyl CoA ligase]
GTGCCGTTCGACCTCGCGCGGGTGCCGGAGGTGCCCCTGGACGGTCTCCTGCGCCGGGCC
GCCGCGGCGGCGCCCGACCGGGTCGCGGTGCGCACCCCGACGGGGACGACGACGTACGCG
GAACTGGACGGCCGAGCCGACGACTGCGCCAGGTCCTTGAGCCGGGCGGCCGGCGGAAGC
GGCACCGCCGTCGGGCTGGTGGCCTCCCTCGACCCGTCGTTCGCGGTCGCCTACTACGGC
GCCGTGCGCGCGGACCACGTCGTCGTGCTGATCAACCCGCACCTGCGGGGTGACGCCCTC
GCCCACGTCCTCTCCGTCGCAGGGACGACGGTGGTGGTGGCCCCGCCCGAGTTCGCCGAG
CGGGTCGCCCAGGTGCGGGGGAAGCTCCCGCACCTGCGTGACGTCCTCTCCCCGGACGTG
CTCGTCCAGGGCCGCGCGGGGCCCGGCGGAAGGGGCCGCGATGCCCCGGGGAGCGCCCCG
CACCTGGACTCGGTGGCGTGCGTCCAGTTCACCAGCGGGACCACGGGGGAACCGAAGGCC
GTTCAGCTGACACACCGCAACCTGGTGGTCAACGCCGCACAGATCGCCTCCGTCCACGGC
CTGGACGGCGACGCGGTGACCCTCAACAACCTGCCGCTCTACCACCCGATGCACCTCAAC
GCCGCGGTGTACGCGGGAGCGACCCAGGTGCTGTGCCCGTCACCCGATCCGGCGGAGGCG
ATCGAGGCCGCGAACCGCCACCGCGCGACGCACTATTACAGCCTTCCCGTACGGCTGGCG
CACCTGGCGGCCGACCCCCGGCTGCCGGGCCTCCGGCTGGAGACGGTCCGCGCGGTCTTC
TCCGGCGGTTCGGCGCTGCTGCCCGCCCAGGCCCGTACCCTGGGGACGCACTTCGGCATC
CCGGTCGTGCAGGGGTACGGACTGGCCGAGACCTCCCCGCTCACACACGGCGAGCCGCCG
GCCCGGCCCCGGCCCGGCTCCGTGGGCCCTGAGGTGCCCGGCACCGAATGCCGGGTGGTG
GACATGGACCGGCGCACCCCGCTCCCGGCCGGGCGGGACGGCGAGATCCAGGTCCGTGGA
CCGCAGCTCATGCGTGGCTACCTCGGCGCCGCCGGCCCCGCGGTCGACGCCGACGGCTGG
TTCTCCACCGGTGACATCGGCCACCGGGACCAGGACGGCTACCTGTACCTGGTGGACCGG
ATCAAGGACGTCTTCAAGTACGAGAACTGGCTGGTGTCACCCACGGAGATCGAGCAGGTC
CTCATCACGCACCCGGCCGTACGGGACTGCGCGGTGGTCGACCACCCGGAACCTTTCAGC
GGCGCGGTGGCCCACGCCTTCGTCGTCCTCGACGAGGATGCCGCACTGCCCGGTCCGGCG
GAGCTCGCCGCCCATGTGAACGATCAGGTCCCCTACTACCAGCAGATCAAGTACCTCGAC
GTGGTGGAACGCGTCCCCCGTTCCCCGAACGGCAAGATCCTCCGCCGCGAACTGCGCGCA
CGTGCCGCGCACACCGACCGGGCCGACCGCCTGCACCCCGGCGCGGCCGGCCGTCCTCAC
TCCGACCTCATAGGAGAGAACCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [38-432]  1.5e-91 PF00501
PF00501   AMP-binding
IPR020845 AMP-binding, conserved site (Conserved_site)
 [168-179]  PS00455
PS00455   AMP_BINDING
IPR025110 Domain of unknown function DUF4009 (Domain)
 [481-503]  2.4e-06 PF13193
PF13193   DUF4009
SignalP No significant hit
TMHMM No significant hit
Chro_00350 Chro_00350   last last