close all open/close all
first first   Chth_00020 Chth_00020

CDS information : Chth_00010


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction672 / 1 / - [in whole cluster]
672 / 1 / - [in contig]
Locationcomplement(1..672) [in whole cluster]
complement(1..672) [in contig]
TypeCDS
Length672 bp (223 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative acetyltransferase
Product (GenBank)acetyltransferase
Gene
Gene (GenBank)orf(-3)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in chlorothricin biosynthesis.
Note (GenBank)
  • Orf(-3)
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)
Family/Domain
FD
IPR000182

close this sectionSequence

selected fasta
>putative acetyltransferase [acetyltransferase]
MTLCALALDDAPALTRIYSGASIRHTTGKPLTLDQAHDQIRTALARAAETPRAQWSWGIL
HESDLIGLISLRRRTPTMGTISYILRDDSWGNGYATHQVVTVAFTTAGLNRLEAVHHPDN
PASGRALTKVGFTHVGTSDRDTEDGTVPYELYALETHGTARTRPSPDRPLSAHERRQRRY
GRLRHGHGTPRGPKGANGRGERIAEHPVGRRVAVPPPLRRRDGS
selected fasta
>putative acetyltransferase [acetyltransferase]
GTGACCCTGTGCGCCCTGGCCCTCGATGACGCCCCCGCCCTCACCCGCATCTACAGCGGG
GCCTCCATCCGGCACACCACCGGCAAGCCCCTCACCCTCGACCAGGCCCACGACCAGATC
CGCACAGCCCTCGCCCGAGCCGCCGAAACCCCCCGCGCGCAGTGGAGCTGGGGCATCCTC
CACGAGAGCGACCTGATCGGCCTGATCTCCCTACGCCGACGCACCCCGACCATGGGCACC
ATCAGCTACATCCTCCGGGACGACAGCTGGGGCAACGGCTACGCCACCCACCAGGTCGTC
ACCGTCGCCTTCACCACCGCCGGCCTCAACCGGCTGGAGGCCGTGCACCACCCCGACAAC
CCCGCCTCCGGCCGCGCCCTGACCAAGGTCGGCTTCACCCACGTCGGGACGTCCGACCGA
GACACCGAAGACGGAACCGTCCCCTATGAGCTGTACGCGCTGGAGACCCACGGCACAGCG
CGCACGAGGCCGTCTCCCGATCGGCCGCTGTCGGCCCATGAGAGGCGTCAGCGCAGGTAC
GGTCGGCTTCGGCACGGACACGGCACACCACGAGGACCCAAGGGGGCCAATGGGCGTGGA
GAACGGATCGCGGAGCATCCCGTGGGGCGGCGAGTGGCGGTACCCCCTCCGCTCCGACGC
CGAGACGGATCC

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000182 GNAT domain (Domain)
 [3-133]  8.89999999999994e-19 PF13302
PF13302   Acetyltransf_3
 [1-154]  PS51186
PS51186   GNAT
IPR016181 Acyl-CoA N-acyltransferase (Domain)
 [1-137]  6.19998763505952e-24 SSF55729
SSF55729   Acyl_CoA_acyltransferase
 [2-139]  2.5e-23 G3DSA:3.40.630.30
G3DSA:3.40.630.30   Acyl_CoA_acyltransferase
SignalP No significant hit
TMHMM No significant hit
first first   Chth_00020 Chth_00020