close all open/close all

CDS information : Chth_00030


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction2,256 / 2,876 / + [in whole cluster]
2,256 / 2,876 / + [in contig]
Location2256..2876 [in whole cluster]
2256..2876 [in contig]
TypeCDS
Length621 bp (206 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
Gene
Gene (GenBank)orf(-1)
EC number
Keyword
Note
  • This ORF is not involved in chlorothricin biosynthesis.
Note (GenBank)
  • predicted hydrolase of HD superfamily; Orf(-1)
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MGRTRWPGGAHPGHRAHAGLALNGTIPPTLARRSPRPRRGPVAVAPQLAAADRGVFFDRL
RDTTEAAARQGEDGVLHRQALYLASYDRGPDAAAWTAHTLHRRRDVPARRGWSPRWAEAR
STATALALLGGPQPLLDFIDRALADDTHKGTASFISEMGVLKRVARTGWWFTGNKQPGSV
AEHSFRVGVIGSVLAMMEGVDPPGSP
selected fasta
>hypothetical protein [unknown]
GTGGGCCGCACCCGCTGGCCGGGGGGTGCACACCCGGGACACCGCGCACATGCTGGCCTG
GCGCTGAACGGCACCATCCCGCCGACGCTCGCCAGACGGTCACCCCGGCCCCGGCGCGGC
CCGGTCGCCGTCGCGCCGCAGCTGGCGGCCGCGGACCGGGGGGTGTTCTTCGACCGCCTG
CGGGACACGACCGAGGCTGCGGCCCGGCAGGGCGAGGACGGGGTGCTGCACCGCCAGGCG
CTCTACCTCGCCTCGTACGACCGAGGCCCGGACGCGGCCGCGTGGACCGCGCACACCCTT
CACCGGCGCCGTGACGTGCCGGCACGGCGGGGCTGGTCCCCGCGCTGGGCGGAGGCCCGC
TCCACCGCCACGGCGCTCGCCCTGCTCGGGGGCCCGCAGCCGCTGCTGGACTTCATCGAC
CGCGCCCTGGCCGACGACACCCACAAGGGCACCGCGAGCTTCATCTCCGAGATGGGCGTG
CTCAAGCGCGTCGCACGGACCGGCTGGTGGTTCACCGGCAACAAGCAGCCGGGGTCCGTG
GCGGAGCACTCCTTCCGTGTCGGGGTGATCGGCTCGGTGCTCGCCATGATGGAGGGCGTC
GACCCGCCCGGGTCACCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006674 HD domain (Domain)
 [147-201]  2e-13 G3DSA:1.10.3210.10
G3DSA:1.10.3210.10   HD
SignalP
 [1-18]  0.334 Signal
Bacteria, Gram-negative   
 [1-31]  0.736 Signal
Eukaryota   
TMHMM No significant hit