close all open/close all

CDS information : Chth_00040


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction3,726 / 2,986 / - [in whole cluster]
3,726 / 2,986 / - [in contig]
Locationcomplement(2986..3726) [in whole cluster]
complement(2986..3726) [in contig]
TypeCDS
Length741 bp (246 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)Orf0
Gene
Gene (GenBank)orf(0)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in chlorothricin biosynthesis.
Note (GenBank)
  • similar to putative IS630 family transposase
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)

close this sectionSequence

selected fasta
>hypothetical protein [Orf0]
MRHPQGGSLTAERQAFRERVRTEAAVMFAEGRGSTDIAKELRVSVRSVVLGAWIVFEDQA
GFPMTPPTSRTWSQRGTAPVIRVRGRSQRRFSIATLCCYKPGERSRLIYRPKRHAGHKSA
GRKSFARTEYRDLLIAAHQQLDAPWSVLRRTTQANTAVTDPSRLIHRLRHGLRQIQYRSD
TIDGCLTGTGLTPTTPRLQRELRGPLELKVRGASPGTVPIRTGSSAATGANPCSARRRRG
PSRTTS
selected fasta
>hypothetical protein [Orf0]
ATGAGGCATCCGCAGGGTGGGAGTCTGACCGCGGAGAGGCAAGCGTTCCGCGAGCGGGTC
CGGACGGAAGCAGCGGTGATGTTCGCCGAGGGGCGGGGCAGCACGGACATCGCGAAGGAG
TTACGGGTCAGCGTCCGGTCGGTGGTGCTCGGGGCCTGGATCGTCTTCGAAGATCAAGCC
GGATTCCCGATGACGCCGCCGACTTCACGCACCTGGAGCCAACGCGGCACTGCACCGGTC
ATCCGGGTCCGCGGCCGTTCCCAGCGTCGCTTCTCCATCGCCACCCTGTGCTGCTACAAA
CCCGGCGAGCGCTCTCGCCTCATCTACCGGCCCAAACGCCATGCAGGTCACAAGAGCGCA
GGCCGCAAGAGCTTCGCGCGGACCGAATACCGCGACCTCCTCATCGCCGCCCACCAGCAG
CTCGACGCACCCTGGTCGGTCCTCCGCCGAACCACCCAGGCCAACACGGCCGTCACCGAC
CCGAGCCGTCTCATCCACCGGCTTCGACACGGCCTCCGCCAGATCCAATACCGCAGCGAC
ACCATCGACGGATGCCTCACCGGAACAGGGCTCACACCGACGACACCACGACTACAACGG
GAGTTGCGAGGACCGTTAGAACTCAAGGTGCGGGGGGCCTCGCCGGGGACGGTGCCGATC
AGGACAGGAAGTTCTGCTGCCACTGGAGCGAATCCATGCTCAGCGCGGCGTCGGCGAGGG
CCTTCGCGGACGACGTCTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit