close all open/close all

CDS information : Chth_00060


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction10,470 / 5,200 / - [in whole cluster]
10,470 / 5,200 / - [in contig]
Locationcomplement(5200..10470) [in whole cluster]
complement(5200..10470) [in contig]
TypeCDS
Length5,271 bp (1,756 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
6-methylsalicylic acid synthase
Product (GenBank)ChlB1
Gene
Gene (GenBank)chlB1
EC number2.3.1.165
Keyword
  • iterative
  • 5-chloro-6-methyl-O-methylsalicylic acid
Note
Note (GenBank)
  • type I PKS
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)
[16677607] Cloning and characterization of a bacterial iterative type I polyketide synthase gene encoding the 6-methylsalicyclic acid synthase. (Biochem Biophys Res Commun. , 2006)
[20534347] Insights into bacterial 6-methylsalicylic acid synthase and its engineering to orsellinic acid synthase for spirotetronate generation. (Chem Biol. , 2010)
[26833898] Insights into 6-Methylsalicylic Acid Bio-assembly by Using Chemical Probes. (Angew Chem Int Ed Engl. , 2016)
Related Reference
ACC
P87162
PmId
[20304931] Hidden function of catalytic domain in 6-methylsalicylic acid synthase for product release. (J Biol Chem. , 2010)
ACC
P22367
PmId
[26833898] Insights into 6-Methylsalicylic Acid Bio-assembly by Using Chemical Probes. (Angew Chem Int Ed Engl. , 2016)

close this sectionPKS/NRPS Module

B1 acetyl-CoA
malonyl-CoA
KS17..391
AT556..871
TH879..1022
KR1380..1575
ACP1661..1734

close this sectionSequence

selected fasta
>polyketide synthase [ChlB1]
MQSHDVARAGGREVVEEPIAVLGMACRFAGGADTLEAFWELLLEGRDGIGEVPEKRWRAY
EEAGPDHAAAVRRATRWGGFLDDIEGFDAEFFGLSPREAELMDPQQRLLLEVAWEALEHA
GIAPRELAGTDAGVFVGIGSDDYGRRLLEDLPGIEAWTGIGSAMCAAANRISYALDLKGP
SLAVDTACSASLVAVHLACQSLRAGESEVSLAAGVNLMISPGLTLTLDAAGATAPDGRSK
SFDASADGYGRGEGCGLLVLKRLSDAVRDGDPVLAVIRGSSVNQDGKTNGIMAPSGSAQE
HVLDLACRRAGVDPASVDYVEAHGTGTRLGDPLEAGALSAVFGRGRPKDEPCLIGSVKSN
IGHLEAAAGIASLIKATLALSKGEIPPSLNFSQGNPAIDWAESGLRVVTERTAWPEREDR
PVRAGVSGFGYGGTIAHVVMEQAPEVSRPDDAAGDEGSAEVVTERLFPLSGGTQAGLRAY
AGRLADRLSDDDAEELPLESVGHTLALRRSALAHRAAVVASDRKDLVAKLRLITLGEQTR
EAVIGSVPSDAGAGPVWVFSGHGSQWSGMGRELLASEPAFAAVIDEIDPVFRAEIGFSAR
QALLDGDFDTVDRVQTMIFAVQVALAAVWHSYGAAPSAVIGHSVGEIAAAVAAGALSLTD
GARLICRRSRLLRRVAGQGAMAMASISFEEAAERLAGRTDVVPAIAASPLSAVVAGDPAA
INALIDEWQAQDIQMRRVASDVAFHSPHMDPLLTEIAAAAEDLTPRQPELPVYSTAMEDP
RSQATLDGSYWAANLRNPVRLQPAVTAAVEDGHRAFIEVSAHPVVTHSIGETLSELGQED
AFTGSSLRRNQPERATLLSAVGAAHCHGIAVDWARLHPTGDLVALPLVAWQRSPHWHERA
SAATGQGLQHDLDSHALLGPRVPVAGRPLELWRTLLDDETRPYPGSHTINGTEIVPAAVL
INTFLDAARAADGARPVLRDMALRLPLITTERRELQVVRDDNSLRLASRSLEDGAAWLTH
TTATAAPAGSGEALQDLAAGAVLRPADPGDVQRHLTSVGVPTMGFEWTIEELARSEGMLA
ARVSVERPQRAQETWAPLLDAALSIAPTAIPGPPALRMVASFEEIVTEGAPPAGPATIQV
AADPVHENTVDVRIADTDGQAVAWVRGLRYDGMDQGGMTAAHPRDLVFEMAWRPFEAPAP
QDVSARRIVLIAAHDVKPLRTALTRAGAHVDVGLDGTLDENTDVVVVPDLTADIPVPEAA
ARSAWLLLSTAQRIAALDTLRFPRLWCLTTAVRESQAETHLAQSTLWGLGRVIAGEHSEL
WGGVIDLAPGTPDATTLLSVLHTGGGEDVIALRDGTATTARLTTTQREPTGTPLECRADG
TYLITGGLGTLGLEVAGRLAERGARRLVLAGRTGLPPRSTWGETTDTHTRQRIEAVKALE
DQGVTVRVIPLDITDTAKAAEQLTPDALGLPPIRGIVHLAGVLDNRMVTAVDETSLRTVL
RPKADGAWTLHTLFPPGTIDFLILFSSCGQLLGLPGQAAYGSANAFLDALAVHRNTTTPT
AADTTSFGWTSWRGQGMAVNDVVDAELRARGVTDITTQEAFAAWDFAAQHGPGNYPVLRR
LPHEPDMDQLPLLSEIHHTQPTAPTSGAATDSYAGLAPDELRARLIDEVAAHISAEMKLA
ASQLDHRKSLVEQGLDSVMTIVIRRRLEKWFGHKLPATLLWHQPTVTAISEHLAELLAPT
TSQPDNTAPAEPAATA
selected fasta
>polyketide synthase [ChlB1]
GTGCAGAGTCACGACGTTGCCCGTGCGGGCGGCAGGGAAGTCGTCGAGGAGCCGATCGCC
GTGCTCGGGATGGCGTGCCGGTTCGCAGGTGGTGCCGACACCCTGGAGGCGTTCTGGGAG
TTGCTGCTGGAGGGCCGGGACGGCATCGGTGAGGTGCCTGAGAAGCGGTGGCGCGCCTAC
GAGGAGGCCGGCCCCGATCATGCGGCGGCGGTGCGGAGGGCGACGCGGTGGGGTGGGTTC
CTCGATGACATCGAGGGGTTCGACGCGGAGTTCTTCGGGTTGTCGCCGCGTGAGGCGGAG
TTGATGGATCCGCAGCAGCGGTTGCTGCTGGAGGTGGCGTGGGAGGCGTTGGAGCACGCG
GGTATTGCGCCGCGGGAGTTGGCGGGGACGGACGCGGGTGTGTTCGTGGGGATCGGTTCG
GATGATTACGGCCGGCGGTTGTTGGAGGATCTGCCGGGGATCGAGGCGTGGACGGGGATC
GGCAGTGCGATGTGTGCGGCGGCGAACCGGATCTCGTATGCGCTGGATCTGAAGGGGCCG
AGTCTGGCGGTGGACACGGCGTGTTCGGCGTCGTTGGTGGCGGTGCATCTGGCGTGTCAG
AGTCTGCGGGCGGGTGAGAGTGAGGTGTCGCTCGCGGCGGGTGTGAATCTGATGATCTCA
CCGGGGTTGACGCTGACGCTGGATGCGGCGGGTGCGACGGCGCCGGACGGGCGGTCGAAG
TCCTTCGATGCCTCCGCGGACGGTTATGGCCGGGGCGAGGGGTGTGGGCTGCTCGTGCTG
AAGCGGTTGTCGGACGCGGTGCGGGACGGGGATCCGGTGCTGGCGGTGATCCGGGGCAGT
TCGGTGAACCAGGACGGGAAGACGAACGGGATCATGGCGCCGAGTGGTTCGGCGCAGGAG
CATGTGCTGGATCTGGCGTGCCGGCGGGCGGGGGTGGATCCGGCGTCGGTGGATTACGTC
GAGGCGCATGGCACGGGGACGCGGCTTGGAGACCCGTTGGAAGCGGGTGCGCTGAGCGCG
GTGTTCGGGCGGGGGCGGCCCAAGGATGAGCCGTGTCTGATCGGTTCGGTGAAGTCGAAC
ATCGGGCATCTGGAGGCGGCGGCGGGGATTGCGAGCCTGATCAAGGCGACGCTGGCGTTG
AGCAAGGGAGAGATCCCGCCGAGTCTGAACTTCTCGCAGGGCAATCCGGCGATCGACTGG
GCGGAGTCCGGGCTGCGGGTGGTGACCGAGCGGACGGCCTGGCCCGAGCGGGAGGACCGA
CCGGTCCGTGCGGGCGTTTCCGGCTTCGGCTATGGCGGCACCATCGCGCATGTGGTCATG
GAGCAGGCGCCTGAGGTGAGTCGGCCCGATGACGCGGCGGGTGATGAGGGGTCTGCCGAG
GTCGTGACGGAGCGGCTGTTCCCGCTCTCGGGTGGAACGCAGGCCGGACTCCGGGCGTAT
GCGGGACGCCTCGCGGACCGGCTGTCGGACGACGACGCCGAGGAACTGCCCCTGGAGTCG
GTCGGGCACACCCTGGCCTTGCGCAGGTCGGCGCTGGCGCACCGGGCCGCCGTCGTGGCC
TCGGACCGCAAGGACCTGGTGGCCAAGCTGCGGTTGATCACGCTGGGGGAGCAGACCCGG
GAAGCCGTGATCGGGTCGGTACCCTCCGATGCCGGTGCGGGGCCGGTGTGGGTGTTCTCC
GGGCATGGTTCGCAGTGGTCGGGGATGGGGCGTGAACTGCTGGCGTCCGAGCCCGCGTTC
GCAGCGGTGATCGACGAGATCGATCCCGTTTTCCGTGCGGAGATCGGGTTCTCGGCCCGG
CAGGCTCTGCTCGACGGTGACTTCGACACCGTCGACCGTGTTCAGACGATGATTTTCGCG
GTGCAGGTCGCGCTGGCGGCGGTCTGGCACTCTTATGGTGCCGCCCCGTCGGCGGTGATC
GGGCACTCCGTGGGGGAGATCGCGGCGGCTGTGGCGGCGGGTGCGCTGTCGCTGACGGAC
GGAGCGCGGCTGATCTGCCGCCGCTCCCGACTCTTGCGGCGGGTGGCCGGCCAGGGAGCG
ATGGCTATGGCGAGCATCTCCTTCGAGGAGGCGGCCGAGCGGCTGGCGGGCCGTACGGAT
GTGGTGCCGGCGATTGCCGCGTCCCCGCTCTCCGCGGTCGTGGCAGGTGACCCTGCAGCG
ATCAACGCGCTGATCGACGAGTGGCAGGCACAGGACATCCAGATGCGCCGGGTCGCCTCG
GACGTGGCCTTCCACAGCCCGCACATGGACCCGCTGCTCACCGAAATCGCGGCCGCTGCC
GAGGACTTGACGCCGCGCCAGCCCGAACTCCCGGTGTACTCCACGGCCATGGAGGACCCC
CGCTCCCAGGCGACCCTCGACGGCTCCTACTGGGCCGCCAACCTGCGTAACCCGGTGCGG
TTGCAGCCGGCGGTGACGGCGGCGGTCGAGGACGGCCACCGCGCGTTCATCGAAGTGTCC
GCGCATCCCGTGGTCACGCACTCCATCGGCGAGACGCTCTCCGAGCTCGGCCAGGAGGAC
GCCTTCACCGGCTCCTCCCTGCGCCGCAACCAGCCCGAACGCGCCACCCTCCTGTCCGCC
GTCGGCGCGGCGCACTGCCATGGCATCGCGGTGGACTGGGCGCGTCTGCACCCGACCGGT
GACCTGGTCGCCCTGCCGCTGGTGGCCTGGCAGCGCAGCCCGCACTGGCACGAGCGGGCC
TCCGCCGCCACCGGCCAGGGCTTGCAGCACGACCTTGACTCCCACGCGCTGCTCGGGCCG
CGCGTCCCGGTCGCGGGACGGCCGCTGGAACTGTGGCGCACACTGCTCGACGACGAGACG
CGCCCCTACCCCGGCAGCCACACCATCAACGGCACGGAGATCGTGCCCGCCGCCGTCCTG
ATCAACACGTTCCTCGACGCGGCACGCGCCGCCGACGGGGCCCGCCCGGTCCTGCGGGAC
ATGGCGCTGCGGCTGCCGCTGATCACCACCGAGCGGCGCGAACTCCAGGTCGTCAGGGAC
GACAACTCCTTGCGTCTGGCCTCGCGTTCACTGGAGGACGGTGCCGCGTGGCTGACCCAC
ACCACCGCCACCGCCGCACCGGCGGGCAGCGGCGAAGCGCTCCAGGACCTGGCCGCCGGT
GCCGTGTTGCGCCCGGCGGACCCGGGTGATGTGCAGCGCCACCTGACCTCGGTGGGCGTG
CCGACCATGGGATTTGAGTGGACCATCGAGGAACTCGCCCGGAGCGAGGGCATGTTGGCC
GCACGTGTGAGTGTCGAGCGGCCGCAGCGGGCCCAGGAGACGTGGGCGCCCTTGCTGGAC
GCCGCGCTGTCCATCGCGCCGACGGCCATCCCCGGCCCGCCGGCCCTGCGCATGGTGGCC
TCCTTCGAGGAGATCGTCACCGAAGGCGCCCCGCCGGCCGGTCCGGCGACCATCCAGGTC
GCGGCCGACCCGGTCCACGAGAACACCGTCGACGTCCGGATCGCCGACACCGACGGGCAG
GCCGTGGCGTGGGTGCGCGGCCTGCGCTACGACGGCATGGACCAGGGCGGCATGACGGCG
GCGCACCCCCGCGACCTGGTCTTCGAGATGGCCTGGCGGCCCTTCGAGGCCCCCGCGCCG
CAGGACGTGTCCGCCCGCCGGATCGTCCTGATCGCCGCACACGACGTGAAGCCCCTGCGC
ACGGCCCTCACCCGTGCCGGCGCTCACGTCGACGTCGGGCTGGACGGCACGCTCGACGAG
AACACCGACGTCGTCGTGGTGCCCGACCTCACCGCGGACATCCCCGTCCCCGAGGCCGCA
GCCCGTTCCGCATGGCTGCTGCTGAGCACCGCGCAGCGCATCGCCGCCCTGGACACCCTG
CGCTTCCCCCGCCTGTGGTGCCTGACCACCGCAGTCCGTGAAAGCCAGGCCGAAACCCAC
CTCGCGCAGTCCACCCTGTGGGGCCTGGGCCGGGTGATCGCGGGCGAGCACAGCGAACTG
TGGGGCGGCGTCATCGACCTGGCCCCCGGCACCCCGGACGCCACCACCCTGCTCAGCGTC
CTGCACACCGGCGGCGGCGAGGACGTCATCGCCCTCCGCGACGGCACCGCCACCACGGCC
CGCCTCACCACGACGCAACGCGAGCCCACTGGCACCCCGCTGGAATGCCGGGCGGACGGA
ACGTACCTGATCACCGGCGGACTGGGCACCCTCGGCCTGGAAGTCGCCGGCCGGCTCGCC
GAACGCGGCGCCCGCCGTCTCGTCCTCGCCGGACGCACCGGACTGCCACCCCGCTCCACC
TGGGGCGAGACCACCGACACGCACACCAGGCAGCGCATCGAGGCCGTCAAGGCCCTCGAA
GACCAGGGCGTCACCGTCCGTGTCATCCCCCTCGACATCACCGACACGGCCAAGGCCGCC
GAACAGCTCACCCCCGACGCCCTGGGCCTGCCACCCATCCGCGGCATCGTCCACCTCGCC
GGCGTCCTCGACAACCGCATGGTGACCGCGGTCGACGAGACATCCCTGCGCACCGTGCTG
CGGCCCAAGGCCGACGGCGCCTGGACCCTGCACACCCTCTTCCCGCCCGGCACCATCGAC
TTCCTGATCCTGTTCTCCTCCTGCGGCCAGCTCCTCGGCCTGCCCGGCCAGGCCGCCTAC
GGCTCCGCCAACGCCTTCCTCGACGCCCTCGCCGTCCACCGCAACACCACCACCCCGACC
GCCGCCGACACCACCAGCTTCGGCTGGACCTCCTGGCGCGGCCAGGGCATGGCCGTCAAC
GACGTCGTCGACGCCGAACTGCGCGCCCGAGGCGTCACCGACATCACCACCCAGGAAGCC
TTCGCCGCCTGGGACTTCGCCGCACAACACGGCCCCGGAAACTACCCCGTCCTACGCCGG
CTGCCCCACGAGCCGGACATGGACCAGCTCCCCCTCCTCAGCGAGATCCACCACACCCAG
CCCACCGCCCCCACCTCCGGCGCCGCAACCGACTCCTACGCGGGCCTCGCCCCCGACGAA
CTGCGCGCCCGCCTCATCGACGAGGTCGCCGCACACATCTCGGCCGAGATGAAACTCGCC
GCCTCCCAGCTCGACCACCGCAAGTCCCTGGTCGAGCAGGGCCTGGACTCGGTGATGACG
ATCGTGATCCGGCGCCGCCTGGAGAAGTGGTTCGGTCACAAACTCCCCGCGACCCTGCTG
TGGCACCAGCCCACCGTCACCGCCATCAGCGAACACCTGGCCGAACTCCTGGCCCCCACC
ACGTCCCAGCCCGACAACACGGCACCCGCCGAACCGGCGGCAACGGCCTGA
[1] KS17..391
[1] AT556..871
[1] acetyl-CoA malonyl-CoA742..746
[1] TH879..1022
[1] KR1380..1575
[1] ACP1661..1734
[1] KS49..1173
[1] AT1666..2613
[1] acetyl-CoA malonyl-CoA2224..2238
[1] TH2635..3066
[1] KR4138..4725
[1] ACP4981..5202

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [555-675]  2.59999999999995e-67 G3DSA:3.40.366.10 [742-860]  2.59999999999995e-67 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR009081 Acyl carrier protein-like (Domain)
 [1668-1733]  1.2e-07 PF00550
PF00550   PP-binding
 [1664-1738]  1.3e-13 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1658-1755]  7.30000590915208e-17 SSF47336
SSF47336   ACP_like
 [1661-1734]  PS50075
PS50075   ACP_DOMAIN
IPR013968 Polyketide synthase, KR (Domain)
 [1380-1574]  5.69999999999998e-52 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [17-266]  2.20000000000002e-93 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [274-391]  2.89999999999999e-45 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [556-871]  4.69999999999992e-98 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [554-837]  2.1000026783403e-61 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [677-741]  4.79999776836274e-10 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [16-277]  8.80000000000003e-97 G3DSA:3.40.47.10 [278-445]  1.40000000000001e-63 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [16-445]  3.699978135861e-101 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1379-1602]  2.4e-30 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [179-195]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [558-851]  3.30001976117415e-95 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1666-1737]  1.10000150671642e-19 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [19-445]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1380-1575]  1.20000117458134e-48 SM00822
SM00822   PKS_KR
SignalP
 [1-37]  0.149 Signal
Bacteria, Gram-positive   
TMHMM No significant hit