close all open/close all

CDS information : Chth_00070


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction11,893 / 10,544 / - [in whole cluster]
11,893 / 10,544 / - [in contig]
Locationcomplement(10544..11893) [in whole cluster]
complement(10544..11893) [in contig]
TypeCDS
Length1,350 bp (449 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative halogenase
Product (GenBank)ChlB4
Gene
Gene (GenBank)chlB4
EC number
Keyword
  • 5-chloro-6-methyl-O-methylsalicylic acid
Note
Note (GenBank)
  • halogenase
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)
Related Reference
ACC
Q9X3R1
NITE
Pyolu_00040
PmId
[10094695] Characterization of the pyoluteorin biosynthetic gene cluster of Pseudomonas fluorescens Pf-5. (J Bacteriol. , 1999)
[16162666] Dichlorination of a pyrrolyl-S-carrier protein by FADH2-dependent halogenase PltA during pyoluteorin biosynthesis. (Proc Natl Acad Sci U S A. , 2005)

close this sectionSequence

selected fasta
>putative halogenase [ChlB4]
MQPDFDAAIVGGGPAGSAMASYLAEAGLSVAVFESEMFPRPHIGESLVPATMPVLDEIGV
MPDIEAAGFPKKYGAAWTSAESRDVPHNGFTGLDHDFKAAEVMFVERDQPGVHRDYTFHV
DRGKFDLILLKHAESRGAQVFQKTRVLKADFDTDPDLVTLNCRLGPRTLDFTTRMVIDAS
GRQTMLGNQLKVKVPDPVFNQYAIHAWFEGLDRTAMALDPAKRDYIYVHFLPLEDTWMWQ
IPITDTITSVGVVTQKHRFKAASADREKFFWDIVSSRKDIYDALQKAERIRPFKAEGDYS
YAMRQICGDRFLLIGDAARFVDPIFSSGVSVALNSARLAAKDVIAAHRAGDFRKESFATY
EEKLRRAVRNWYEFISVYYRLNILFTAFVQDPRYRIDVLKMLQGDFYDGEEPKALKAMRD
LVTKVENDPEHLWHPYLGTLRAPSAAPTF
selected fasta
>putative halogenase [ChlB4]
ATGCAGCCCGATTTCGACGCCGCGATCGTCGGCGGCGGCCCCGCCGGTTCGGCCATGGCC
TCCTATCTCGCCGAAGCCGGCCTGTCCGTGGCCGTGTTCGAGAGCGAGATGTTCCCGCGG
CCCCACATCGGGGAGTCGCTCGTCCCCGCGACCATGCCGGTCCTCGACGAGATCGGAGTG
ATGCCCGACATCGAGGCCGCCGGCTTCCCGAAGAAATACGGGGCCGCGTGGACCTCGGCC
GAATCGCGCGACGTGCCGCACAACGGATTCACCGGACTCGACCACGACTTCAAGGCTGCC
GAGGTCATGTTCGTCGAGCGGGACCAGCCCGGCGTCCACCGCGACTACACGTTCCACGTC
GACCGCGGGAAGTTCGACCTCATCCTGCTCAAGCACGCGGAGAGCCGCGGCGCCCAGGTG
TTCCAGAAGACCCGCGTCCTCAAGGCCGACTTCGACACCGACCCTGACCTGGTCACCCTG
AACTGCCGACTGGGCCCGCGCACGCTCGACTTCACCACCCGCATGGTGATCGACGCCTCC
GGCCGGCAGACCATGCTCGGCAACCAGCTCAAGGTGAAGGTCCCCGACCCCGTCTTCAAC
CAGTACGCCATCCACGCCTGGTTCGAGGGACTTGACCGCACGGCCATGGCCCTCGACCCC
GCCAAGCGCGACTACATTTATGTGCACTTCCTTCCGCTCGAAGACACCTGGATGTGGCAG
ATCCCCATCACGGACACCATCACCAGCGTGGGCGTGGTGACCCAGAAGCACCGCTTCAAG
GCCGCCAGCGCCGACCGCGAGAAGTTCTTCTGGGACATCGTCTCCAGCCGCAAGGACATC
TACGACGCGCTCCAGAAGGCCGAGCGGATCCGCCCGTTCAAGGCCGAGGGCGACTACAGC
TACGCCATGCGGCAGATCTGCGGCGACCGGTTCCTGCTGATCGGCGACGCCGCCCGGTTC
GTCGACCCCATCTTCTCCAGCGGCGTCAGCGTCGCCCTCAACAGCGCCCGGCTCGCCGCG
AAGGACGTGATCGCCGCCCATCGGGCGGGCGACTTCCGCAAGGAGAGCTTCGCGACATAC
GAGGAGAAGCTCCGCCGGGCCGTGCGCAACTGGTACGAATTCATCTCGGTCTACTACCGC
CTGAACATCCTCTTCACCGCGTTCGTCCAGGACCCGCGCTACCGCATCGACGTACTGAAG
ATGCTCCAGGGCGACTTCTACGACGGTGAGGAACCGAAGGCGCTCAAGGCCATGCGCGAC
CTCGTGACCAAGGTCGAGAACGATCCCGAACACCTCTGGCACCCGTACCTCGGCACGCTC
CGGGCCCCCTCGGCAGCACCCACGTTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [5-369]  1.1e-20 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [6-28]  1.6999992228405e-08 PR00420 [308-323]  1.6999992228405e-08 PR00420
PR00420   RNGMNOXGNASE
SignalP
 [1-26]  0.203 Signal
Bacteria, Gram-negative   
TMHMM No significant hit