close all open/close all

CDS information : Chth_00080


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction12,179 / 11,913 / - [in whole cluster]
12,179 / 11,913 / - [in contig]
Locationcomplement(11913..12179) [in whole cluster]
complement(11913..12179) [in contig]
TypeCDS
Length267 bp (88 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productacyl carrier protein
Product (GenBank)ChlB2
Gene
Gene (GenBank)chlB2
EC number
Keyword
  • 5-chloro-6-methyl-O-methylsalicylic acid
  • modification base
Note
Note (GenBank)
  • discrete ACP
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)
[19266533] Dissection of two acyl-transfer reactions centered on acyl-S-carrier protein intermediates for incorporating 5-chloro-6-methyl-O-methylsalicyclic acid into chlorothricin. (Chembiochem. , 2009)
Related Reference
ACC
Q9X3R0
NITE
Pyolu_00030
PmId
[11880032] Conversion of L-proline to pyrrolyl-2-carboxyl-S-PCP during undecylprodigiosin and pyoluteorin biosynthesis. (Chem Biol. , 2002)

close this sectionSequence

selected fasta
>acyl carrier protein [ChlB2]
MTAEEYAAKLIPFIQENLLPKDSGITVDASTPLLELGVLDSLKTAILMNYIRGELGVVIP
PEQLSSSNFASPGTIVTVIHDLAASNAG
selected fasta
>acyl carrier protein [ChlB2]
ATGACAGCAGAAGAATACGCGGCGAAACTCATCCCGTTCATTCAGGAGAACCTTCTGCCG
AAGGACTCCGGCATCACGGTGGACGCCTCGACGCCGCTTCTGGAGCTGGGAGTTCTCGAC
TCGCTCAAGACGGCGATCCTGATGAACTACATACGCGGCGAACTGGGCGTCGTCATCCCT
CCCGAGCAGCTCAGCAGCAGCAATTTCGCCTCGCCCGGGACCATCGTCACGGTCATCCAC
GACCTCGCCGCCTCGAACGCCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [2-83]  7.60000011115813e-08 SSF47336
SSF47336   ACP_like
 [26-65]  4.5e-06 PF00550
PF00550   PP-binding
 [4-82]  2.9e-12 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
SignalP No significant hit
TMHMM No significant hit