close all open/close all

CDS information : Chth_00090


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction13,289 / 12,246 / - [in whole cluster]
13,289 / 12,246 / - [in contig]
Locationcomplement(12246..13289) [in whole cluster]
complement(12246..13289) [in contig]
TypeCDS
Length1,044 bp (347 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Product6-methylsalicylyltransferase
Product (GenBank)ChlB3
Gene
Gene (GenBank)chlB3
EC number
Keyword
  • 5-chloro-6-methyl-O-methylsalicylic acid
  • modification base
Note
Note (GenBank)
  • ketoacyl-ACP synthase; condensing protein
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)
[19266533] Dissection of two acyl-transfer reactions centered on acyl-S-carrier protein intermediates for incorporating 5-chloro-6-methyl-O-methylsalicyclic acid into chlorothricin. (Chembiochem. , 2009)

close this sectionSequence

selected fasta
>6-methylsalicylyltransferase [ChlB3]
MRTPDIFIKATGRFLPETVSVEWAVEQGHYSAEDAELHELGGAAVAGDTPAPDMALWAAQ
QAVKRCGHRPEDLGLLLYVDSWHQGPDGWQPQYYLQRHLVGGDVLAVEIQQGCNGMFSAL
ELAAAHLRAGPRPGSALVVAADNFGTPLFDRWTTGPGYIAGDGAGAVVLTTEPGFARLLA
VRSLAVPEAEQMHRGAEPLFPPGATIGRPLNFTSRNAAFRELSLTEGLGTGALMRVHQRT
LEVVEKTLSEAGITLGDITRVAYMNFSREIVEQRCMAALGLPMSASTWEFGRKLGHLGAS
DQVVALDELVTTGELGPGDHLLMLGMGPGVTLSCAVVKVLTPAPWSD
selected fasta
>6-methylsalicylyltransferase [ChlB3]
GTGCGGACGCCCGACATATTCATCAAGGCGACGGGGAGATTCCTCCCGGAGACGGTCAGT
GTCGAGTGGGCCGTGGAACAGGGCCACTACTCGGCCGAGGACGCCGAGTTGCACGAGCTG
GGCGGCGCCGCAGTCGCCGGGGACACCCCCGCTCCCGACATGGCCCTGTGGGCCGCACAG
CAGGCTGTCAAACGGTGCGGACACCGGCCGGAGGACCTGGGCCTGCTGCTGTACGTCGAC
TCCTGGCACCAGGGCCCGGACGGCTGGCAGCCCCAGTACTACCTCCAGCGCCACCTCGTC
GGCGGTGACGTCCTCGCGGTGGAGATCCAGCAGGGCTGCAATGGCATGTTCAGCGCCCTC
GAACTGGCGGCGGCCCACCTGCGGGCCGGACCGCGGCCAGGCTCGGCCCTGGTCGTCGCC
GCGGACAACTTCGGCACCCCGCTCTTCGACCGCTGGACCACGGGCCCGGGCTACATCGCC
GGGGACGGCGCCGGCGCCGTCGTCCTGACCACCGAGCCCGGATTCGCCCGTCTGCTGGCC
GTGCGGTCCCTCGCCGTACCCGAGGCCGAACAGATGCATCGCGGCGCCGAACCGCTGTTC
CCGCCGGGAGCCACGATCGGCCGCCCCCTGAACTTCACCTCCCGCAATGCCGCCTTCCGT
GAGCTGAGCCTGACCGAGGGCCTGGGCACCGGGGCACTCATGCGGGTGCACCAGCGGACC
CTCGAAGTCGTCGAAAAGACCCTCTCCGAGGCGGGAATCACCCTCGGCGACATCACGCGC
GTCGCCTACATGAATTTCTCCCGGGAAATCGTCGAACAGCGGTGCATGGCGGCCCTCGGC
CTCCCGATGTCCGCCTCGACCTGGGAATTCGGCAGAAAGCTCGGACACCTCGGCGCGAGC
GACCAGGTCGTCGCACTGGACGAGCTGGTGACGACCGGCGAACTGGGCCCCGGCGACCAC
CTGTTGATGCTCGGCATGGGGCCAGGCGTCACGCTCTCCTGCGCCGTCGTGAAGGTGCTC
ACGCCGGCTCCCTGGAGCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013747 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal (Domain)
 [248-338]  8.20000000000006e-20 PF08541
PF08541   ACP_syn_III_C
IPR013751 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III (Domain)
 [108-174]  8.3e-13 PF08545
PF08545   ACP_syn_III
IPR016038 Thiolase-like, subgroup (Domain)
 [3-165]  5.69999999999998e-22 G3DSA:3.40.47.10 [166-174]  2.3e-22 G3DSA:3.40.47.10 [207-338]  2.3e-22 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [3-339]  1.70000295590054e-29 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit