close all open/close all

CDS information : Chth_00100


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction13,750 / 13,337 / - [in whole cluster]
13,750 / 13,337 / - [in contig]
Locationcomplement(13337..13750) [in whole cluster]
complement(13337..13750) [in contig]
TypeCDS
Length414 bp (137 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)ChlH
Gene
Gene (GenBank)chlH
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)

close this sectionSequence

selected fasta
>hypothetical protein [ChlH]
MLSRPFVGGSVWPAPDDGRSTAPWARQVPGSPDGHRQTESAVGASSPTGIGGESSGQDGR
RPAERGFGLGRTMVEWCPGRAAPLASISSGRPADRKICATVPVPPASGHHSAPGHCERAG
DGPSPVLRPPSPVLRPP
selected fasta
>hypothetical protein [ChlH]
ATGCTGAGCCGGCCTTTCGTCGGTGGTTCGGTATGGCCGGCGCCGGACGACGGTCGGTCG
ACGGCGCCGTGGGCGAGGCAGGTCCCGGGCTCGCCGGATGGTCACCGGCAGACGGAATCC
GCGGTCGGCGCGTCGTCGCCGACCGGCATCGGGGGGGAGTCGTCAGGGCAGGACGGACGT
CGTCCCGCAGAGCGCGGGTTCGGGTTGGGCAGGACGATGGTCGAGTGGTGCCCGGGTCGT
GCGGCCCCGCTCGCCAGCATATCGAGCGGACGCCCGGCGGACCGCAAGATCTGCGCCACG
GTCCCCGTACCGCCCGCTTCCGGCCACCACTCCGCTCCCGGTCACTGCGAAAGAGCCGGT
GACGGCCCTTCGCCGGTGCTCAGGCCGCCTTCGCCGGTGCTTAGACCGCCTTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit