close all open/close all

CDS information : Chth_00110


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction13,782 / 14,498 / + [in whole cluster]
13,782 / 14,498 / + [in contig]
Location13782..14498 [in whole cluster]
13782..14498 [in contig]
TypeCDS
Length717 bp (238 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)ChlB5
Gene
Gene (GenBank)chlB5
EC number
Keyword
  • 5-chloro-6-methyl-O-methylsalicylic acid
Note
Note (GenBank)
  • O-methyltransferase
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)

close this sectionSequence

selected fasta
>hypothetical protein [ChlB5]
MERVLQRLDQENVDSFQQAVTTGTWSGDPFALAQLPLSVGAETGDLIYLTARAARVTRAV
DFATSVGASLIYLAAAVRDNGGGLVIGAELVPAKVEAARRNVDEAGLTDYVEIREGDARE
TLADVGGPIDYAIVDGFHATDSSWTADGGTSLALDVLKLLTPQLRSGAILVNDNAEPDYL
EYVRDRRNGFRSSWITVIPRHAQKADGELVASLRKLPADAPLLALMPKVPGLELSVRD
selected fasta
>hypothetical protein [ChlB5]
GTGGAGCGGGTCCTCCAGCGCCTCGACCAGGAGAACGTCGACTCGTTCCAGCAGGCGGTC
ACAACGGGCACCTGGAGCGGGGACCCCTTCGCGCTGGCGCAGCTCCCGCTCTCGGTCGGC
GCGGAGACCGGCGATCTGATCTATCTGACGGCGCGGGCGGCCCGGGTCACCCGCGCGGTC
GACTTCGCGACATCCGTCGGGGCCTCCCTGATCTACCTCGCGGCGGCCGTACGGGACAAC
GGCGGCGGGCTGGTGATCGGCGCCGAGCTGGTGCCGGCCAAGGTCGAGGCGGCCCGGCGC
AATGTCGACGAGGCGGGGCTCACGGACTACGTCGAGATCCGCGAGGGTGACGCACGCGAG
ACGCTCGCCGACGTCGGCGGGCCGATCGACTACGCGATCGTCGACGGATTCCATGCCACC
GACAGCAGCTGGACCGCCGACGGCGGCACGTCGCTGGCGCTCGATGTGCTGAAGCTGCTC
ACCCCGCAGCTGCGGTCCGGCGCCATCCTCGTCAACGACAACGCCGAGCCCGACTATCTG
GAGTACGTGCGGGACCGGCGCAACGGCTTCCGCTCCAGCTGGATCACCGTGATACCCCGC
CACGCACAAAAGGCCGACGGCGAGCTGGTCGCGAGCCTGAGGAAACTGCCCGCCGACGCC
CCGCTGCTGGCCCTGATGCCGAAGGTCCCGGGGCTGGAACTGTCGGTGCGCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit