close all open/close all

CDS information : Chth_00120


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction14,736 / 15,794 / + [in whole cluster]
14,736 / 15,794 / + [in contig]
Location14736..15794 [in whole cluster]
14736..15794 [in contig]
TypeCDS
Length1,059 bp (352 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Product5-chloro-6-methyl-O-methylsalicylyltransferase
Product (GenBank)ChlB6
Gene
Gene (GenBank)chlB6
EC number
Keyword
  • 5-chloro-6-methyl-O-methylsalicylic acid
Note
Note (GenBank)
  • ketoacyl-ACP synthase; condensing protein
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)
[19266533] Dissection of two acyl-transfer reactions centered on acyl-S-carrier protein intermediates for incorporating 5-chloro-6-methyl-O-methylsalicyclic acid into chlorothricin. (Chembiochem. , 2009)

close this sectionSequence

selected fasta
>5-chloro-6-methyl-O-methylsalicylyltransferase [ChlB6]
MKVSGIHVWSIGLYHATQWMSPDEARAAGLCDDEFPEGDLKGVQIAPGIPPVDMAVAAAR
EAIGRAGVAPAGIDLLVHAPCFWNGPEEWSPAGYLLRELGCPDGSGQVLDQGCNGMLAAL
EMAAGWLTLRGGDATALLTTATMVDGSPTIDRWRSAGYGIAIGDGAGAIVLGRRPGLAEI
SAVNSTTVPEMEQFHRGALPLIEPTPPLRPKVDVLARARENAALGAQNGLELQRLQIQAY
QKAMARTLDDVGIGPEDLAKVLFAHVGGAQTDAIVMQQLGLPLAKSTWDHGRSIGHVGAS
DHVYDLEHLITSGELSEGDRLLLVCGTAGFHITSLVLTVGDLSPYERYQRDT
selected fasta
>5-chloro-6-methyl-O-methylsalicylyltransferase [ChlB6]
ATGAAGGTCAGCGGCATCCACGTCTGGTCGATCGGGCTGTACCACGCCACGCAGTGGATG
AGCCCGGACGAGGCGCGAGCAGCCGGGCTCTGCGACGACGAGTTTCCCGAGGGAGATCTG
AAGGGCGTGCAGATCGCCCCCGGGATCCCTCCGGTCGACATGGCGGTGGCGGCGGCCCGG
GAGGCGATCGGCCGGGCCGGCGTCGCCCCGGCCGGGATCGACCTGCTGGTCCACGCGCCG
TGCTTCTGGAACGGCCCGGAGGAGTGGTCGCCCGCCGGCTATCTCCTGCGGGAACTCGGC
TGTCCGGACGGCTCGGGGCAGGTGCTCGACCAGGGCTGCAACGGCATGCTGGCCGCGCTG
GAGATGGCGGCGGGCTGGCTCACCCTGCGGGGCGGCGACGCCACGGCGCTGCTCACCACG
GCGACCATGGTGGACGGCTCCCCCACCATCGACCGCTGGCGCAGCGCCGGATACGGCATC
GCGATCGGCGACGGGGCCGGCGCGATCGTGCTGGGGCGGCGGCCGGGCCTCGCGGAGATC
TCGGCCGTCAACTCCACCACCGTCCCGGAGATGGAGCAGTTCCATCGCGGCGCGCTGCCG
CTGATCGAGCCGACGCCTCCGCTGCGGCCGAAGGTCGATGTGCTGGCCCGCGCCCGGGAG
AACGCCGCCCTGGGAGCCCAGAACGGGCTGGAGCTCCAGCGCCTGCAGATCCAGGCGTAC
CAGAAGGCCATGGCGCGGACGCTGGACGATGTGGGCATCGGCCCGGAGGATCTCGCCAAG
GTGCTGTTCGCGCATGTCGGCGGGGCGCAGACCGACGCGATCGTGATGCAGCAGCTGGGG
CTGCCGCTGGCCAAGTCGACCTGGGACCACGGCCGTTCGATCGGCCATGTCGGCGCGAGC
GACCATGTCTACGACCTGGAGCACCTCATCACCTCGGGCGAGCTGTCCGAGGGCGACCGG
CTCCTGCTGGTCTGCGGGACGGCGGGGTTCCACATCACCAGCCTGGTGCTGACGGTCGGT
GATCTCTCCCCGTACGAGCGGTATCAGCGGGACACGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013747 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal (Domain)
 [248-338]  1.1e-11 PF08541
PF08541   ACP_syn_III_C
IPR013751 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III (Domain)
 [110-174]  5.2e-06 PF08545
PF08545   ACP_syn_III
IPR016038 Thiolase-like, subgroup (Domain)
 [5-168]  2.7e-23 G3DSA:3.40.47.10 [169-176]  8.40000000000001e-22 G3DSA:3.40.47.10 [211-338]  8.40000000000001e-22 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [50-339]  1.79999754022375e-26 SSF53901
SSF53901   Thiolase-like
SignalP
 [1-27]  0.187 Signal
Bacteria, Gram-positive   
 [1-27]  0.279 Signal
Bacteria, Gram-negative   
 [1-27]  0.255 Signal
Eukaryota   
TMHMM No significant hit