close all open/close all

CDS information : Chth_00130


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction16,608 / 15,865 / - [in whole cluster]
16,608 / 15,865 / - [in contig]
Locationcomplement(15865..16608) [in whole cluster]
complement(15865..16608) [in contig]
TypeCDS
Length744 bp (247 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 ketoreductase
Product (GenBank)ChlC5
Gene
Gene (GenBank)chlC5
EC number
Keyword
  • D-olivose
Note
Note (GenBank)
  • 4-ketoreductase
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)
Related Reference
ACC
Q9L4S5
NITE
Urd_00250
PmId
[11094336] The NDP-sugar co-substrate concentration and the enzyme expression level influence the substrate specificity of glycosyltransferases: cloning and characterization of deoxysugar biosynthetic genes of the urdamycin biosynthetic gene cluster. (Chem Biol. , 2000)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 ketoreductase [ChlC5]
MEVIGRGFLARYLASLGTRHPHVTALAAGVSTTGDAGQAAYQREAQLLYDVIGRCRRQDR
TLLFFSTASAGMYGGSGCQGREDGPVYPQSPYGHHKLALESVIRLSGTRYLIIRLSHVLG
PHQPAHQMLPTLIRAVRAGRVDVHRGACRDVIDVSDAVSDVDTLLCAGVSDQVVNVASGV
AVPAEHIIDHLEARLGGPLDRRFVDRPSRYEISLEKLSELTAGKAGQPYPADYYKTVIDN
CLSTAAL
selected fasta
>putative NDP-hexose C-4 ketoreductase [ChlC5]
ATGGAAGTCATAGGCAGGGGTTTCCTTGCCCGCTATCTCGCCTCGCTCGGCACCCGTCAT
CCCCACGTGACGGCGCTGGCGGCGGGCGTGTCGACGACCGGTGACGCGGGGCAGGCCGCC
TACCAGCGCGAGGCGCAACTGCTCTACGACGTCATCGGCAGATGCCGCCGCCAGGACCGC
ACACTGCTGTTCTTCTCCACGGCCTCCGCCGGCATGTACGGAGGCTCCGGCTGCCAGGGC
CGCGAGGACGGCCCGGTCTACCCCCAATCCCCTTATGGACACCACAAACTGGCACTCGAA
AGCGTCATCCGGCTGTCCGGTACGCGCTATCTGATCATCCGGCTCAGCCATGTACTGGGC
CCCCACCAGCCGGCCCACCAGATGCTGCCCACGCTGATCCGGGCGGTGCGCGCAGGCCGG
GTCGACGTGCACCGCGGGGCCTGCCGCGACGTCATCGACGTGTCGGACGCGGTGTCCGAC
GTCGACACCCTGCTGTGCGCCGGTGTGAGCGACCAGGTGGTCAACGTCGCCTCCGGGGTC
GCGGTCCCCGCCGAGCACATCATCGACCATCTGGAGGCGCGCCTCGGCGGCCCCCTCGAC
CGCAGGTTCGTGGACCGCCCCAGCCGCTACGAGATCTCGCTGGAGAAACTGTCCGAACTG
ACCGCGGGCAAGGCCGGGCAGCCGTACCCCGCGGACTACTACAAGACGGTGATCGACAAC
TGTCTGAGCACGGCCGCCCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [22-176]  6.90000000000001e-16 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [24-191]  9.60000000000004e-18 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-27]  0.366 Signal
Bacteria, Gram-positive   
TMHMM No significant hit