close all open/close all

CDS information : Chth_00140


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction17,666 / 16,671 / - [in whole cluster]
17,666 / 16,671 / - [in contig]
Locationcomplement(16671..17666) [in whole cluster]
complement(16671..17666) [in contig]
TypeCDS
Length996 bp (331 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-3 ketoreductase
Product (GenBank)ChlC4
Gene
Gene (GenBank)chlC4
EC number
Keyword
  • D-olivose
Note
Note (GenBank)
  • 3-ketoreductase
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)
Related Reference
ACC
Q9ALN5
NITE
Spino_00080
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose C-3 ketoreductase [ChlC4]
MNPTTGGTALRIGVLGCADIAWRNTLPAILRVPEVRLTALASRDPAKARTFADRFGGTPV
QGYDALLARDDVDAVYVALPTALHHPWARRALLAGKHVWAEKPLAATAEQAEDLVRLART
HDRVLRDGFSFPHHSQHAVVAKLIAEGRIGEPRAFAGAFGIPPRPAGDVRYSAELGGGAL
LDVGVYPVRAAQLLLGDDLAVAGSVLRMDRARGVDLAGSGLLHTPDGRTASLDFGFDRSY
RSRYAVWGSEGRLSLDRAFTPPAAHRPVLRIQRQDHYEELSLAPDDQLAGLVRAFADAVR
EGGDPRPYEATLLRHAALTDEIRVGARRVAD
selected fasta
>putative NDP-hexose C-3 ketoreductase [ChlC4]
ATGAACCCGACCACCGGTGGTACGGCGCTGCGCATCGGCGTGCTGGGATGCGCCGACATC
GCCTGGCGCAACACCCTGCCCGCCATCCTGCGAGTGCCCGAGGTGCGGCTGACCGCCCTC
GCCAGCCGGGACCCGGCCAAGGCCCGCACCTTCGCCGACCGTTTCGGCGGCACACCCGTC
CAGGGATACGACGCACTCCTCGCCCGCGACGACGTGGACGCCGTCTACGTGGCACTGCCC
ACGGCACTGCACCACCCCTGGGCGCGCCGCGCACTGCTGGCCGGCAAGCACGTGTGGGCC
GAGAAGCCGCTCGCCGCCACCGCCGAGCAGGCCGAGGACCTGGTCCGGCTCGCCCGCACC
CACGACCGGGTGCTCCGGGACGGCTTCTCCTTCCCGCACCACAGCCAGCACGCCGTCGTC
GCCAAGCTGATCGCCGAGGGGCGCATCGGGGAACCCCGGGCGTTCGCGGGCGCCTTCGGC
ATCCCGCCGCGCCCCGCCGGGGACGTCCGCTACAGTGCCGAACTCGGCGGCGGTGCCCTG
CTCGACGTCGGCGTCTACCCGGTCCGCGCGGCCCAGCTCCTCCTCGGTGACGACCTCGCC
GTCGCCGGATCCGTCCTGCGCATGGACCGGGCCCGGGGCGTGGACCTGGCCGGCTCCGGG
CTGCTGCACACCCCCGACGGGCGCACCGCCTCACTGGACTTCGGCTTCGACCGCAGCTAC
CGCTCCCGCTACGCCGTCTGGGGCAGCGAGGGCCGGCTGTCGCTGGACCGCGCCTTCACC
CCGCCCGCCGCGCACCGGCCGGTCCTCAGGATCCAGCGCCAGGACCACTACGAGGAGCTG
TCGCTCGCGCCGGACGACCAACTGGCCGGGCTCGTCCGGGCGTTCGCCGACGCGGTGCGC
GAGGGAGGTGACCCCCGTCCCTACGAGGCCACCCTGCTTCGGCACGCGGCCCTGACCGAC
GAGATCAGGGTGGGCGCCCGGCGCGTCGCCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000683 Oxidoreductase, N-terminal (Domain)
 [10-127]  1.9e-25 PF01408
PF01408   GFO_IDH_MocA
IPR004104 Oxidoreductase, C-terminal (Domain)
 [142-245]  2.5e-08 PF02894
PF02894   GFO_IDH_MocA_C
IPR016040 NAD(P)-binding domain (Domain)
 [8-151]  2.19999999999997e-43 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-48]  0.316 Signal
Bacteria, Gram-positive   
TMHMM No significant hit