close all open/close all

CDS information : Chth_00150


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction19,014 / 17,698 / - [in whole cluster]
19,014 / 17,698 / - [in contig]
Locationcomplement(17698..19014) [in whole cluster]
complement(17698..19014) [in contig]
TypeCDS
Length1,317 bp (438 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose 2,3-dehydratase
Product (GenBank)ChlC3
Gene
Gene (GenBank)chlC3
EC number
Keyword
  • D-olivose
Note
Note (GenBank)
  • 2,3-dehydratase
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)
Related Reference
ACC
Q9ALN6
NITE
Spino_00070
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose 2,3-dehydratase [ChlC3]
MTEAAVDTPFRAWWREQASAQRSEVARIPFAELDGWGFEPHGGNLVHASGKFFTVEGLRI
EPDDGREARQPIIHQPEIGVLGILVKEFDGVVHCLMQAKMEPGNLNTVQLSPTVQATRSN
YLRVHRGGRTRYLEHFWGAGRGRVLVDVLQSEQGAWFWHKRNRNMIVQVDGDVPVHEAFR
WVALPELLALLHSDNLVNMDARTVLGCLPRDLLPRQGRTGAFAAALRCSYETGADAGAAR
SWLLDVKSRGRWTTRLIPLNDTHGWIRKSDEISADDGSGFRIIAVRVRSRSREVPEWTQP
LLAPRDEGLAAFLVRRAGGTLQVLVQARYEPGLLEHVELAPTVRTPPVTADEEVPYLKDV
LSADHRNIRFDALLSEEGGRFHHALTRYQVIEVADGQTLEVGDNHRWMTIGQLMELVRHG
HYLNIEARSLLACLHSLR
selected fasta
>putative NDP-hexose 2,3-dehydratase [ChlC3]
GTGACTGAAGCAGCAGTGGATACCCCCTTCCGCGCCTGGTGGCGGGAGCAAGCGTCGGCC
CAGCGGTCGGAGGTGGCACGCATCCCGTTCGCGGAGCTCGACGGCTGGGGCTTCGAACCG
CACGGCGGGAACCTGGTGCACGCGAGCGGGAAGTTCTTCACCGTCGAGGGCCTGCGCATA
GAACCCGACGATGGACGGGAAGCCCGCCAGCCGATCATCCATCAGCCCGAGATCGGCGTT
CTCGGTATCCTGGTCAAGGAGTTCGACGGGGTCGTGCACTGCCTGATGCAGGCCAAGATG
GAGCCCGGAAACCTCAACACCGTCCAGCTCTCGCCGACGGTCCAGGCGACCCGCAGCAAC
TACCTGCGGGTACACCGCGGCGGCCGCACCCGCTATCTGGAGCACTTCTGGGGAGCAGGG
CGCGGCAGGGTGCTCGTGGACGTCCTGCAGTCCGAACAGGGCGCCTGGTTCTGGCACAAA
CGCAACCGCAACATGATCGTCCAAGTGGACGGCGATGTGCCCGTGCACGAGGCCTTCCGC
TGGGTGGCCCTGCCCGAGCTGCTGGCCCTGCTGCACAGCGACAACCTCGTCAACATGGAC
GCCCGCACCGTACTGGGCTGCCTGCCACGGGACTTGCTGCCCCGCCAGGGCCGTACGGGC
GCCTTCGCCGCGGCGCTGCGCTGCTCGTACGAGACCGGTGCCGACGCCGGGGCCGCGCGC
AGCTGGCTGCTCGATGTGAAAAGCCGCGGCCGCTGGACGACCCGGCTGATCCCGCTGAAC
GACACCCACGGCTGGATCCGGAAAAGCGACGAGATCAGCGCCGACGACGGCTCGGGATTC
CGGATCATCGCGGTCCGGGTGCGCTCCCGCAGCCGTGAAGTCCCCGAATGGACCCAGCCG
TTGCTGGCCCCCCGGGACGAGGGTCTGGCCGCCTTCCTGGTCCGGCGCGCCGGCGGCACC
CTGCAGGTGCTGGTCCAGGCGCGCTACGAGCCCGGCCTGCTGGAGCACGTGGAGCTGGCG
CCCACGGTCCGCACCCCACCGGTCACCGCCGACGAGGAGGTGCCCTACCTGAAGGACGTG
CTGTCCGCCGACCACCGCAACATCCGCTTCGACGCCCTGCTGTCCGAGGAGGGCGGGCGC
TTCCACCATGCGCTCACGCGCTACCAGGTGATCGAGGTGGCGGACGGGCAGACGCTCGAA
GTCGGCGACAACCACCGGTGGATGACGATCGGTCAGCTCATGGAACTGGTGCGGCACGGC
CACTACCTGAACATCGAGGCCCGCAGCCTGCTCGCCTGCCTGCACAGCCTGCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005212 NDP-hexose 2,3-dehydratase (Domain)
 [8-208]  5.30000000000001e-79 PF03559 [237-434]  5.00000000000001e-68 PF03559
PF03559   Hexose_dehydrat
SignalP No significant hit
TMHMM No significant hit