close all open/close all

CDS information : Chth_00160


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction19,374 / 19,162 / - [in whole cluster]
19,374 / 19,162 / - [in contig]
Locationcomplement(19162..19374) [in whole cluster]
complement(19162..19374) [in contig]
TypeCDS
Length213 bp (70 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative acyl-CoA carboxylase epsilon subunit
Product (GenBank)ChlI
Gene
Gene (GenBank)chlI
EC number
Keyword
Note
Note (GenBank)
  • coupling protein of carboxyl transferase
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)
Related Reference
ACC
O86518
PmId
[11526020] Role of an essential acyl coenzyme A carboxylase in the primary and secondary metabolism of Streptomyces coelicolor A3(2). (Appl Environ Microbiol. , 2001)
[12048195] Kinetic and structural analysis of a new group of Acyl-CoA carboxylases found in Streptomyces coelicolor A3(2). (J Biol Chem. , 2002)

close this sectionSequence

selected fasta
>putative acyl-CoA carboxylase epsilon subunit [ChlI]
MSAADIADDVLRVEKGHPGPEELAAVTAVLLARSARSGPAPAQDGRDRAVWRRLERDGGF
PLAHSWRSVA
selected fasta
>putative acyl-CoA carboxylase epsilon subunit [ChlI]
ATGAGCGCCGCAGACATCGCCGACGACGTCCTGCGCGTCGAGAAGGGCCACCCCGGGCCC
GAGGAACTCGCCGCCGTCACCGCCGTACTGCTCGCCCGCAGCGCGCGATCCGGTCCGGCT
CCGGCGCAGGACGGCCGGGACAGGGCGGTCTGGCGCCGCCTGGAGCGGGACGGCGGATTC
CCACTGGCCCACAGCTGGCGGTCGGTGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit