close all open/close all

CDS information : Chth_00170


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction21,002 / 19,395 / - [in whole cluster]
21,002 / 19,395 / - [in contig]
Locationcomplement(19395..21002) [in whole cluster]
complement(19395..21002) [in contig]
TypeCDS
Length1,608 bp (535 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative acyl-CoA carboxylase beta subunit
Product (GenBank)ChlJ
Gene
Gene (GenBank)chlJ
EC number
Keyword
Note
Note (GenBank)
  • carboxyl transferase
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)
Related Reference
ACC
O86517
PmId
[11526020] Role of an essential acyl coenzyme A carboxylase in the primary and secondary metabolism of Streptomyces coelicolor A3(2). (Appl Environ Microbiol. , 2001)
[12048195] Kinetic and structural analysis of a new group of Acyl-CoA carboxylases found in Streptomyces coelicolor A3(2). (J Biol Chem. , 2002)
ACC
Q9X4K7
PmId
[10589718] Genetic and biochemical characterization of the alpha and beta components of a propionyl-CoA carboxylase complex of Streptomyces coelicolor A3(2). (Microbiology. , 1999)
[12048195] Kinetic and structural analysis of a new group of Acyl-CoA carboxylases found in Streptomyces coelicolor A3(2). (J Biol Chem. , 2002)

close this sectionSequence

selected fasta
>putative acyl-CoA carboxylase beta subunit [ChlJ]
MAPIQRAGEAGPAGAPEQADGLRGRTAELHGIRARALAGPGEKATAAQHAKGKLTARERI
ELLLDAGSFQEVEQLRRHRAAGFGLEAKKPYTDGVITGWGTVHGRTVFVYAHDFRIFGGA
LGEAHAQKIHKLMDMAIAAGAPLVSLNDGAGARIQEGVSALAGYGGIFQRNTKASGVIPQ
ISVMLGPCAGGAAYSPALTDFVFMVRETSQMFITGPDVVKAVTGEEITQNGLGGADVHAE
TSGVCHFAYDDEETCIAEVRYLLSLLPQNNRENPPRVESADPADRRSDVLLDLVPADGNR
PYDMAKVIEEIVDDGDYLEVHERWARNIICALARLDGRVVGIIANQPQTLAGVLDIEASE
KAARFVQMCDAFNIALITLLDVPGFLPGVGQEHGGIIRHGAKLLYAYCNATVPRISLIVR
KAYGGAYIVMDSQSIGADLTYAWPTNEIAVMGAVGAANVVFRRQIAAAPDPDAMRARLVK
EYRAELMHPYYAVERGLVDDVIDPAETREVLVRALAMLRLKHADLPSRKHGNPPQ
selected fasta
>putative acyl-CoA carboxylase beta subunit [ChlJ]
ATGGCACCTATACAAAGGGCCGGGGAGGCCGGACCCGCCGGCGCGCCCGAGCAGGCGGAC
GGACTGCGCGGCCGTACCGCCGAACTGCACGGGATTCGTGCGCGGGCGCTGGCCGGACCG
GGCGAGAAGGCGACCGCGGCGCAGCACGCGAAGGGCAAGCTGACCGCCCGGGAGCGGATC
GAACTGCTGCTCGACGCCGGTTCCTTCCAGGAGGTCGAGCAGCTGCGCCGGCACCGCGCG
GCCGGTTTCGGCCTGGAGGCGAAGAAGCCGTACACCGACGGCGTGATCACCGGCTGGGGC
ACGGTCCACGGCCGGACGGTCTTCGTCTACGCCCACGACTTCCGGATCTTCGGCGGCGCG
CTGGGCGAGGCCCACGCCCAGAAGATCCACAAGCTGATGGACATGGCGATCGCGGCGGGT
GCGCCGCTGGTGTCGCTGAACGACGGCGCCGGCGCCCGCATCCAGGAAGGCGTCTCGGCG
CTCGCCGGCTACGGCGGCATCTTCCAGCGCAACACCAAGGCCAGCGGTGTCATCCCGCAG
ATCAGCGTGATGCTCGGCCCGTGCGCGGGCGGCGCGGCCTACAGCCCCGCCCTGACCGAC
TTCGTGTTCATGGTCCGCGAGACCTCGCAGATGTTCATCACCGGCCCGGACGTGGTCAAG
GCCGTCACCGGCGAGGAGATCACCCAGAACGGGCTGGGCGGCGCCGACGTGCACGCCGAG
ACTTCCGGTGTGTGCCACTTCGCCTACGACGACGAGGAGACGTGCATCGCCGAGGTGCGC
TACCTCCTCTCCCTGCTCCCGCAGAACAACCGCGAGAACCCCCCGCGCGTGGAGAGCGCC
GACCCGGCCGACCGCCGCTCGGACGTGCTCCTCGACCTGGTCCCGGCCGACGGCAACCGG
CCCTACGACATGGCGAAGGTCATCGAGGAGATCGTCGACGACGGCGACTACCTGGAGGTC
CACGAGCGCTGGGCCCGCAACATCATCTGCGCGCTGGCCCGCCTGGACGGCCGGGTCGTC
GGCATCATCGCCAACCAGCCGCAGACCCTCGCCGGCGTCCTCGACATCGAGGCCAGCGAG
AAGGCCGCGCGCTTCGTCCAGATGTGCGACGCCTTCAACATCGCGCTGATCACGCTGCTC
GACGTCCCGGGCTTCCTTCCGGGCGTCGGTCAGGAGCACGGCGGCATCATCCGGCACGGC
GCCAAACTGCTGTACGCCTACTGCAACGCGACGGTGCCGAGGATCTCCTTGATCGTGCGC
AAGGCGTACGGAGGTGCCTACATCGTCATGGACAGCCAGTCCATCGGCGCCGACCTCACC
TACGCGTGGCCGACGAACGAGATCGCCGTCATGGGCGCCGTGGGCGCCGCGAATGTGGTC
TTCCGGCGTCAGATCGCGGCCGCGCCCGACCCCGACGCCATGCGCGCCCGCCTGGTCAAG
GAGTACAGGGCCGAACTCATGCACCCGTACTACGCCGTCGAGCGCGGCCTCGTGGACGAC
GTCATCGACCCGGCCGAGACGCGCGAGGTCCTGGTCAGGGCCCTGGCCATGCTCCGGCTC
AAGCACGCCGACCTGCCCTCGCGCAAGCACGGCAACCCCCCACAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000022 Carboxyl transferase (Domain)
 [47-532]  PF01039
PF01039   Carboxyl_trans
IPR011762 Acetyl-coenzyme A carboxyltransferase, N-terminal (Domain)
 [28-242]  PS50980
PS50980   COA_CT_NTER
IPR011763 Acetyl-coenzyme A carboxyltransferase, C-terminal (Domain)
 [243-527]  PS50989
PS50989   COA_CT_CTER
SignalP No significant hit
TMHMM No significant hit