close all open/close all

CDS information : Chth_00180


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction21,139 / 21,747 / + [in whole cluster]
21,139 / 21,747 / + [in contig]
Location21139..21747 [in whole cluster]
21139..21747 [in contig]
TypeCDS
Length609 bp (202 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductTetR family transcriptional regulator
Product (GenBank)ChlF1
Gene
Gene (GenBank)chlF1
EC number
Keyword
Note
Note (GenBank)
  • transcriptional regulator
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)
[26750095] Coordinative Modulation of Chlorothricin Biosynthesis by Binding of the Glycosylated Intermediates and End Product to a Responsive Regulator ChlF1. (J Biol Chem. , 2016)

close this sectionSequence

selected fasta
>TetR family transcriptional regulator [ChlF1]
MTGSRARLLAAAAEEFAQYGLRGTRIQAIVDRAGVNERMIYHHFGSKEGLYKAALEDQMK
ALHDAWHPALQRAVTLPPYEGMAMALTALGDALASLPSLVGLWLHESLNDWQTLPLPSTD
ALPTELQKLYERGQEEGVFRQDCPFEIAHGVAMSALIGSAILGPRGDALISRQTAGLGLE
KIRELTLGQLLDGMTGPSAASV
selected fasta
>TetR family transcriptional regulator [ChlF1]
ATGACAGGAAGCAGGGCTCGACTGCTCGCGGCAGCCGCCGAGGAGTTCGCCCAGTACGGC
CTGAGAGGCACACGCATCCAAGCGATCGTCGACCGGGCCGGCGTCAATGAGCGAATGATC
TATCACCACTTCGGCAGCAAAGAGGGCCTCTACAAGGCCGCCCTCGAAGACCAGATGAAG
GCACTGCACGACGCCTGGCATCCGGCCCTGCAGCGAGCCGTGACCCTGCCGCCCTACGAA
GGCATGGCGATGGCGCTGACCGCCCTCGGCGACGCCCTGGCCAGCCTGCCCTCCCTGGTG
GGCCTCTGGCTCCATGAATCCCTCAACGACTGGCAGACCCTGCCCCTCCCGTCGACCGAC
GCCCTCCCCACCGAGCTGCAGAAGCTCTACGAGCGCGGACAGGAGGAAGGAGTGTTCCGC
CAGGACTGCCCCTTCGAGATAGCTCACGGGGTCGCCATGAGCGCGCTCATCGGTAGCGCG
ATCCTGGGCCCGCGCGGGGACGCCCTGATCAGCCGTCAGACCGCCGGACTCGGCCTGGAG
AAGATCCGTGAGCTGACGCTCGGACAGCTTCTGGACGGCATGACCGGCCCCTCGGCGGCA
AGCGTCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [8-21]  1.10000029896148e-08 PR00455 [29-52]  1.10000029896148e-08 PR00455
PR00455   HTHTETR
 [2-62]  PS50977
PS50977   HTH_TETR_2
 [8-53]  1.6e-15 PF00440
PF00440   TetR_N
IPR009057 Homeodomain-like (Domain)
 [4-73]  5.99999044089058e-17 SSF46689
SSF46689   Homeodomain_like
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [76-142]  6.5000009155689e-06 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [4-198]  1.5e-31 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
SignalP No significant hit
TMHMM No significant hit