close all open/close all

CDS information : Chth_00190


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction21,904 / 23,370 / + [in whole cluster]
21,904 / 23,370 / + [in contig]
Location21904..23370 [in whole cluster]
21904..23370 [in contig]
TypeCDS
Length1,467 bp (488 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance transporter
Product (GenBank)ChlG
Gene
Gene (GenBank)chlG
EC number
Keyword
Note
Note (GenBank)
  • export protein
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)
Related Reference
ACC
P42670
PmId
[7916693] The pur8 gene from the pur cluster of Streptomyces alboniger encodes a highly hydrophobic polypeptide which confers resistance to puromycin. (Eur J Biochem. , 1993)
Family/Domain
FD
IPR004638

close this sectionSequence

selected fasta
>putative drug resistance transporter [ChlG]
MSASTQVNETAGDRLPPRLISLMVTVALGSIMMQMDATMTNIAYNTLLKEFDTTLLTIQW
VTTGYLLAMAAVMAISGWAMERFGARTMWITSITLFLVGSVLCGAAWDAHSLIAFRVIQG
LGGGMVLPLGMAVLAQEAGPGRLGRVMGVLGIPSALGPVLGPVVGGAIVDDWNWRWIFFI
NVPVCVAAIVIAWRTMPSRKSPTAGRLDVLGLLLLSPACAVAVFGLTQASKYGSFADRHT
VIPLAIGLALLAAFAVHALRTENPILDLRLLKVRSFLSSSAVLFFASVALFGAVGVLPLY
FQQVRHHSALEAGLLLAPQGVGMAVSLLVVGKVADKTSPRLLVIGGLALTAVGALVCTQL
AADTNVVLLGAALALSGAGTGMVMAPAMAGAIRDIPGPVIPRASAANRIIMQIGSSFGSA
VLILVAQNRMDHLIETRDLTPDSLAGAYGITFWWVIGFVVVSVLLALLIPSRKPTQHQHA
GEASVPVL
selected fasta
>putative drug resistance transporter [ChlG]
ATGAGCGCTTCCACGCAAGTCAACGAGACAGCCGGCGATCGTCTTCCGCCCCGGCTGATC
AGCCTCATGGTCACGGTGGCCCTCGGGTCGATCATGATGCAGATGGACGCCACGATGACC
AACATCGCCTACAACACGTTGCTGAAGGAGTTCGACACCACCCTGCTCACCATCCAGTGG
GTCACCACCGGCTACCTCCTGGCGATGGCCGCCGTCATGGCGATCTCCGGCTGGGCCATG
GAGCGCTTCGGCGCCCGGACCATGTGGATCACCAGCATCACCCTCTTCCTCGTCGGGTCC
GTGCTGTGCGGTGCCGCCTGGGACGCCCACAGCCTCATCGCGTTCCGGGTCATCCAGGGT
CTCGGCGGCGGCATGGTGCTGCCGCTCGGCATGGCGGTCCTCGCGCAGGAGGCCGGGCCG
GGCCGACTGGGCCGGGTGATGGGCGTCCTGGGCATTCCCTCCGCCCTCGGGCCGGTGCTC
GGCCCGGTGGTGGGCGGCGCCATCGTGGACGACTGGAACTGGCGGTGGATCTTCTTCATC
AACGTGCCGGTGTGCGTCGCCGCCATCGTGATCGCCTGGCGGACCATGCCCTCGCGCAAG
TCACCGACCGCCGGACGCCTGGACGTCCTGGGTCTGCTGCTGCTCTCCCCCGCCTGCGCC
GTGGCGGTGTTCGGACTCACCCAGGCCAGCAAGTACGGGTCGTTCGCGGACCGTCATACG
GTCATTCCGCTGGCCATCGGGCTCGCGCTGCTCGCCGCGTTCGCGGTGCACGCGCTGCGC
ACCGAGAATCCCATCCTGGACCTGCGGCTGCTCAAGGTCCGCAGCTTCCTGTCCTCGTCG
GCCGTGCTGTTCTTCGCGAGCGTGGCGCTGTTCGGCGCGGTGGGTGTGCTGCCGCTCTAC
TTCCAGCAGGTGCGCCACCACAGCGCGCTGGAGGCCGGTCTGCTGCTCGCCCCGCAGGGC
GTCGGCATGGCCGTGTCACTGCTCGTCGTCGGCAAGGTCGCGGACAAGACCTCGCCGCGG
CTGCTCGTCATCGGCGGGCTCGCCCTCACCGCCGTCGGTGCGCTGGTGTGCACCCAGCTC
GCCGCGGACACCAATGTCGTCCTCCTCGGCGCCGCGCTCGCGCTCAGCGGTGCCGGCACC
GGCATGGTGATGGCACCCGCCATGGCCGGGGCGATCCGGGACATCCCGGGGCCGGTGATC
CCCCGGGCCAGCGCGGCGAACCGGATCATCATGCAGATCGGCTCCTCGTTCGGCTCGGCC
GTGCTGATCCTCGTGGCCCAGAACCGTATGGACCATCTGATCGAGACGAGGGACCTCACA
CCCGACAGCCTGGCCGGTGCCTACGGCATCACCTTCTGGTGGGTCATCGGGTTCGTGGTC
GTGTCCGTCCTGCTCGCCCTGCTCATCCCGTCCCGCAAGCCGACACAGCACCAGCACGCC
GGGGAAGCGTCGGTCCCCGTCCTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001411 Tetracycline resistance protein TetB/drug resistance transporter (Family)
 [116-136]  1.19999985703101e-05 PR01036 [146-170]  1.19999985703101e-05 PR01036
PR01036   TCRTETB
IPR004638 Drug resistance transporter EmrB/QacA subfamily (Family)
 [20-431]  8.29999999999993e-100 TIGR00711
TIGR00711   Efflux_EmrB
IPR011701 Major facilitator superfamily (Family)
 [27-418]  8.79999999999995e-53 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-484]  5.39997012872478e-78 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [22-474]  PS50850
PS50850   MFS
SignalP No significant hit
TMHMM
 [21-43]  Transmembrane (i-o) [58-80]  Transmembrane (o-i) [87-109]  Transmembrane (i-o) [113-135]  Transmembrane (o-i) [147-169]  Transmembrane (i-o) [174-196]  Transmembrane (o-i) [209-226]  Transmembrane (i-o) [241-259]  Transmembrane (o-i) [280-302]  Transmembrane (i-o) [312-334]  Transmembrane (o-i) [341-360]  Transmembrane (i-o) [370-392]  Transmembrane (o-i) [405-427]  Transmembrane (i-o) [447-469]  Transmembrane (o-i)
Transmembrane 14