close all open/close all

CDS information : Chth_00200


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction24,370 / 23,585 / - [in whole cluster]
24,370 / 23,585 / - [in contig]
Locationcomplement(23585..24370) [in whole cluster]
complement(23585..24370) [in contig]
TypeCDS
Length786 bp (261 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)ChlF2
Gene
Gene (GenBank)chlF2
EC number
Keyword
  • SARP family
Note
Note (GenBank)
  • response regulator of 2-component system
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)
Related Reference
ACC
Q846W3
NITE
Monen_00280
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)

close this sectionSequence

selected fasta
>putative transcriptional regulator [ChlF2]
MLGPLRVVDGTRCSSVNARKVEILFSVLLIRAEQVVSSEQLMGEIWGEDLPRRATAGLHV
YISQLRKFLKRPGRSTSPVETRAPGYVLHIGDDEIDAHVFPRRVEEGRTLLRQGRYEEAT
RCFERALDLWRGPLLGPGGNGRDANGPIIDGFSTWLTETRLECQEMLAECRLHVGRHRET
VGTLYALTAENPMRETFYRQLMLALYRSERQADALKVYQAARRTLKDELGLEPGRALQEL
QRAILAGDNRLMTVPAARSDR
selected fasta
>putative transcriptional regulator [ChlF2]
ATGCTTGGTCCGCTCCGCGTCGTGGACGGGACCCGGTGTTCATCTGTGAATGCCCGCAAA
GTGGAGATCCTCTTCTCGGTCCTGCTCATCAGGGCCGAACAGGTCGTCTCCTCGGAGCAG
TTGATGGGGGAGATCTGGGGCGAGGACCTGCCCCGCCGGGCCACCGCGGGACTTCATGTG
TACATCTCGCAGCTGCGCAAGTTCCTCAAGCGGCCCGGCCGCTCCACCAGCCCCGTCGAG
ACCCGCGCCCCGGGCTATGTGCTGCACATCGGCGACGACGAGATCGACGCTCATGTCTTC
CCCCGACGCGTCGAGGAGGGACGGACCCTCCTCCGGCAGGGCCGCTACGAAGAGGCCACG
CGGTGCTTCGAGCGAGCCCTCGACCTGTGGCGAGGACCGCTCCTGGGGCCCGGAGGCAAC
GGCCGGGACGCCAACGGCCCGATCATCGACGGATTCTCGACCTGGCTCACCGAAACCCGC
CTGGAATGCCAGGAGATGCTCGCCGAGTGCCGGCTCCATGTCGGGCGCCACCGGGAGACC
GTGGGCACGCTCTACGCGCTCACCGCCGAGAACCCGATGCGCGAGACCTTCTACCGTCAG
CTGATGCTGGCGCTGTACCGGTCGGAACGGCAGGCCGACGCGCTGAAGGTCTATCAGGCG
GCGCGCCGGACCCTCAAGGACGAACTGGGCCTGGAGCCCGGCCGTGCGCTGCAGGAGCTG
CAGCGCGCCATCCTCGCCGGGGACAACCGTCTGATGACGGTGCCCGCAGCCCGCTCCGAC
CGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [24-88]  2.3e-12 PF00486
PF00486   Trans_reg_C
 [10-88]  3.7999986264479e-11 SM00862
SM00862   Trans_reg_C
IPR005158 Bacterial transcriptional activator domain (Domain)
 [95-245]  1.40000000000001e-49 PF03704
PF03704   BTAD
 [95-245]  1.99999636034521e-49 SM01043
SM01043   BTAD
IPR011990 Tetratricopeptide-like helical (Domain)
 [105-225]  7.90000000000001e-10 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [16-89]  3.3e-10 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [1-89]  1.59999889349252e-11 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-32]  0.308 Signal
Eukaryota   
TMHMM No significant hit