close all open/close all

CDS information : Chth_00210


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction25,179 / 24,379 / - [in whole cluster]
25,179 / 24,379 / - [in contig]
Locationcomplement(24379..25179) [in whole cluster]
complement(24379..25179) [in contig]
TypeCDS
Length801 bp (266 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)ChlK
Gene
Gene (GenBank)chlK
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
  • type II TE
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)
Related Reference
ACC
Q846W2
NITE
Monen_00290
PmId
[16984884] Identification of NanE as the thioesterase for polyether chain release in nanchangmycin biosynthesis. (Chem Biol. , 2006)
ACC
Q7BUF9
NITE
Rifam_00540
PmId
[19103602] Structure and functional analysis of RifR, the type II thioesterase from the rifamycin biosynthetic pathway. (J Biol Chem. , 2009)

close this sectionSequence

selected fasta
>putative type II thioesterase [ChlK]
MSPTPDATDAWMRRIRPHADASVRLVCFPHAGGSATYYHPLAHSLARIPGAEVLAVQYPG
RQDRRREPFVDSVPLLADHVTAALNPLADRPLVLFGHSMGATLAYEVAHRLRARRPESEP
RWLLVSGRRAPSRFREGTVHLRTDAQLVEELRRVGGTDPAFLDDPELLDTILPVIRNDYR
AIESYRWTPAPPLTCPVTVLVGAQDPQTTLDEAAAWREHTSGPFALRDFPGGHFYLDVHR
QGVADALSQALERVARPMETLGGNGR
selected fasta
>putative type II thioesterase [ChlK]
TTGTCTCCTACTCCCGACGCGACGGATGCGTGGATGCGGCGCATCCGGCCCCACGCGGAC
GCTTCGGTCCGGCTCGTGTGTTTCCCGCACGCGGGTGGATCGGCCACCTACTACCACCCC
CTGGCCCACTCGCTCGCCCGGATACCCGGGGCCGAGGTGCTCGCGGTGCAGTACCCCGGC
CGGCAGGACCGGCGCAGGGAGCCATTCGTCGACAGTGTCCCCCTCCTCGCCGACCATGTC
ACCGCAGCCCTGAACCCGTTGGCCGACCGCCCGCTCGTCCTCTTCGGGCACAGCATGGGC
GCCACCCTCGCCTACGAGGTGGCCCACCGCCTCCGTGCGCGGCGGCCGGAGAGCGAACCG
AGGTGGCTGCTCGTCTCCGGGCGCCGGGCTCCGTCCCGCTTCCGCGAGGGGACGGTGCAT
CTGCGCACCGACGCCCAACTCGTCGAGGAACTGCGCCGCGTCGGCGGCACCGACCCCGCC
TTCCTCGACGACCCGGAGCTCCTGGACACGATCCTCCCGGTCATCCGCAACGACTACCGG
GCGATCGAGAGCTACCGCTGGACGCCGGCGCCACCCCTGACCTGCCCGGTCACCGTCTTG
GTCGGCGCCCAGGACCCGCAGACCACTCTCGACGAGGCGGCCGCGTGGCGCGAACACACC
AGCGGACCCTTCGCGTTGCGGGACTTCCCCGGTGGTCACTTCTACCTGGACGTCCACCGG
CAAGGCGTGGCCGACGCCCTCTCGCAGGCTCTGGAGCGGGTGGCCCGCCCGATGGAAACG
CTTGGAGGCAACGGACGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [24-244]  7.29999999999998e-57 PF00975
PF00975   Thioesterase
SignalP No significant hit
TMHMM No significant hit