close all open/close all

CDS information : Chth_00220


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction27,064 / 26,081 / - [in whole cluster]
27,064 / 26,081 / - [in contig]
Locationcomplement(26081..27064) [in whole cluster]
complement(26081..27064) [in contig]
TypeCDS
Length984 bp (327 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-glucose 4,6-dehydratase
Product (GenBank)ChlC2
Gene
Gene (GenBank)chlC2
EC number4.2.1.46
Keyword
  • D-olivose
Note
Note (GenBank)
  • dDNP-glucose-4,6-dehydratase
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)
Related Reference
ACC
Q9ZGH3
NITE
Pikro_00130
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[14570895] High resolution X-ray structure of dTDP-glucose 4,6-dehydratase from Streptomyces venezuelae. (J Biol Chem. , 2004)
ACC
Q56173
NITE
Grana_00110
PmId
[7476861] Identification of Streptomyces violaceoruber Tu22 genes involved in the biosynthesis of granaticin. (Mol Gen Genet. , 1995)
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)
ACC
Q194R3
NITE
Mith_00070
PmId
[9150235] Cloning and insertional inactivation of Streptomyces argillaceus genes involved in the earliest steps of biosynthesis of the sugar moieties of the antitumor polyketide mithramycin. (J Bacteriol. , 1997)

close this sectionSequence

selected fasta
>putative dTDP-glucose 4,6-dehydratase [ChlC2]
MRYFVTGGAGFIGGHYVRALLAGAYPGTAGCEVTVLDKLTYAAHLDNLPLDHDRLTFVRG
DICDAGLLADLLPGHDAVVHFAAESHVDRSLADGTPFVTTNVLGTQILLDACARTGVPRF
VHVSTDEVYGSLRHGSWTEDTLLEPNSPYAASKAASDLMARAYWRTSDVAVSITRCSNNY
GTHQFIEKVVPLFVTNLLDGLDVPLYGDGHHVREWLHVEDHCRALHLVLTEGRAGEIYNI
GAGDGLTNRELTQRLLTLCGADWSRVREVPDRTAHDERYSVDTAKIREELGFTPRIGLDE
GLADVVAWYRDNRAWWEPLRERAALPA
selected fasta
>putative dTDP-glucose 4,6-dehydratase [ChlC2]
ATGAGGTACTTCGTCACCGGCGGCGCCGGATTCATCGGCGGCCACTATGTGCGCGCCCTG
CTCGCCGGCGCCTACCCGGGCACCGCCGGCTGCGAGGTCACCGTCCTGGACAAGCTGACC
TACGCGGCCCACCTCGACAACCTCCCCCTGGACCACGACCGGTTGACCTTCGTACGCGGC
GACATCTGCGACGCCGGCCTGCTGGCGGACCTGCTGCCCGGACATGACGCCGTGGTGCAC
TTCGCCGCCGAGTCGCACGTCGACCGCTCCCTCGCCGACGGCACGCCCTTCGTGACGACG
AACGTGCTCGGCACCCAGATCCTCCTCGACGCCTGCGCCCGCACGGGCGTTCCGCGGTTC
GTCCATGTCTCCACCGACGAGGTCTACGGCTCACTGCGGCACGGCTCCTGGACCGAGGAC
ACCCTCCTGGAGCCCAACTCCCCGTACGCGGCCTCGAAGGCGGCGAGCGATCTGATGGCC
CGCGCCTACTGGCGCACCAGCGATGTCGCCGTCTCCATCACACGGTGCTCCAACAACTAC
GGCACCCACCAGTTCATCGAGAAGGTCGTACCGCTGTTCGTGACCAACCTGCTGGACGGC
CTGGACGTGCCGCTGTACGGGGACGGTCACCATGTGCGCGAGTGGCTGCATGTCGAGGAC
CACTGCCGCGCCCTCCACCTGGTGCTCACCGAGGGGCGCGCCGGCGAGATCTACAACATC
GGTGCCGGAGACGGGCTGACCAACCGGGAACTGACGCAGCGTCTGCTCACGCTCTGCGGG
GCGGACTGGAGCCGGGTGCGCGAGGTTCCCGACCGGACGGCCCACGACGAGCGGTACTCG
GTCGACACGGCGAAGATCCGCGAGGAGCTGGGCTTCACACCGAGGATCGGGCTGGACGAG
GGACTGGCGGACGTCGTGGCCTGGTACCGCGACAACCGCGCGTGGTGGGAGCCGCTGCGC
GAGCGGGCGGCCCTGCCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [4-241]  1.20000000000001e-65 PF01370
PF01370   Epimerase
IPR005888 dTDP-glucose 4,6-dehydratase (Family)
 [3-319]  5.09999999999993e-116 TIGR01181
TIGR01181   DTDP_gluc_dehyt
IPR016040 NAD(P)-binding domain (Domain)
 [1-188]  9.69999999999989e-62 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-30]  0.345 Signal
Eukaryota   
TMHMM No significant hit