close all open/close all

CDS information : Chth_00230


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction28,145 / 27,078 / - [in whole cluster]
28,145 / 27,078 / - [in contig]
Locationcomplement(27078..28145) [in whole cluster]
complement(27078..28145) [in contig]
TypeCDS
Length1,068 bp (355 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glucose-1-phosphate thymidylyltransferase
putative dTDP-glucose synthase
Product (GenBank)ChlC1
Gene
Gene (GenBank)chlC1
EC number2.7.7.24
Keyword
  • D-olivose
Note
Note (GenBank)
  • dDNP-glucose synthase
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)
Related Reference
ACC
Q194R4
NITE
Mith_00060
PmId
[9150235] Cloning and insertional inactivation of Streptomyces argillaceus genes involved in the earliest steps of biosynthesis of the sugar moieties of the antitumor polyketide mithramycin. (J Bacteriol. , 1997)

close this sectionSequence

selected fasta
>putative glucose-1-phosphate thymidylyltransferase [ChlC1]
MKSLVLSGGTGSRLRPLSHSMPKQLVPVANKPVLFHALEALAAAGVTETGIVINAGNTAI
PAAVGDGARFGMTVTYLPQESPQGLAHCVMIARDFLADDDFVMYLGDNVFGSGIAEELQT
FRRERPTTQLLLSKVVNPSAYGIAELDGQGRVTVLEEKPARPRSDLAVTGAFCFTPEIHE
AVRNTKPSWRGELEITDAIQWLVSHDREVRGTVYPGFWKDTGTLQDLLDCNRVLLEAVEP
GVQGTVDTLSRVYGPVVVEPGARVERSVLVGPTVIGAGSIVEDSYVGAFSSLGRGCRLQD
AGVESSIILDHAAVHGVRTLYDSIVGKGGEVRLCSEPVPRHRLMVGDDCRIEIPA
selected fasta
>putative glucose-1-phosphate thymidylyltransferase [ChlC1]
ATGAAATCCCTCGTTCTGTCGGGCGGCACCGGATCGCGGTTGCGTCCGCTCAGCCACAGC
ATGCCCAAGCAGTTGGTGCCCGTCGCCAACAAGCCCGTCCTCTTCCACGCCCTCGAGGCC
CTCGCCGCCGCCGGCGTCACGGAGACCGGCATCGTCATCAACGCCGGCAACACCGCGATC
CCCGCGGCCGTGGGCGACGGCGCACGCTTCGGCATGACCGTCACCTACCTGCCGCAGGAG
TCTCCGCAGGGCCTGGCGCACTGCGTCATGATCGCCCGCGACTTCCTCGCCGACGACGAC
TTCGTCATGTACCTGGGCGACAACGTCTTCGGCTCCGGCATCGCCGAGGAACTTCAGACG
TTCCGCCGCGAACGGCCCACGACCCAGCTCCTGCTGTCGAAGGTCGTCAACCCCAGCGCG
TACGGCATCGCCGAGCTGGACGGCCAGGGCCGGGTCACCGTCCTGGAGGAGAAACCCGCC
CGGCCGCGCAGCGATCTCGCGGTGACCGGTGCCTTCTGCTTCACACCGGAGATCCACGAG
GCCGTGCGCAACACCAAGCCGAGCTGGCGCGGCGAGCTGGAGATCACGGACGCCATCCAG
TGGCTGGTGAGCCACGACCGTGAGGTGCGGGGCACGGTGTACCCGGGCTTCTGGAAGGAC
ACCGGAACCCTGCAGGACCTCCTCGACTGCAACCGCGTCCTGCTGGAGGCCGTCGAGCCC
GGCGTCCAGGGCACGGTCGACACGCTCAGCAGGGTCTACGGCCCGGTCGTGGTCGAGCCC
GGCGCGCGCGTCGAGCGGTCCGTCCTCGTGGGCCCGACCGTCATCGGCGCCGGAAGCATC
GTCGAGGACAGCTATGTGGGCGCGTTCAGCTCGCTCGGCCGGGGCTGCCGGCTCCAGGAC
GCGGGCGTGGAGTCGTCGATCATCCTGGACCACGCCGCCGTCCACGGGGTCCGCACCCTG
TACGACTCCATCGTCGGCAAGGGCGGCGAGGTGCGTCTGTGCTCCGAACCGGTGCCCCGG
CACCGGCTGATGGTCGGCGACGACTGCCGTATCGAGATCCCCGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [2-235]  5.10000000000004e-53 PF00483
PF00483   NTP_transferase
IPR005908 Glucose-1-phosphate thymidylyltransferase, long form (Family)
 [2-352]  3.30000000000002e-119 TIGR01208
TIGR01208   RmlA_long
SignalP
 [1-43]  0.153 Signal
Eukaryota   
TMHMM No significant hit