close all open/close all

CDS information : Chth_00240


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction29,477 / 28,263 / - [in whole cluster]
29,477 / 28,263 / - [in contig]
Locationcomplement(28263..29477) [in whole cluster]
complement(28263..29477) [in contig]
TypeCDS
Length1,215 bp (404 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glycosyltransferase
Product (GenBank)ChlC6
Gene
Gene (GenBank)chlC6
EC number
Keyword
Note
Note (GenBank)
  • glycosyltransferase
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)
Related Reference
ACC
Q70J70
NITE
Chro_00280
PmId
[16391039] Deoxysugar transfer during chromomycin A3 biosynthesis in Streptomyces griseus subsp. griseus: new derivatives with antitumor activity. (Appl Environ Microbiol. , 2006)
ACC
Q194P9
NITE
Mith_00260
PmId
[10660060] Characterization of two glycosyltransferases involved in early glycosylation steps during biosynthesis of the antitumor polyketide mithramycin by Streptomyces argillaceus. (Mol Gen Genet. , 2000)

close this sectionSequence

selected fasta
>putative glycosyltransferase [ChlC6]
MLFIPLAVASHYYPMVPLAWALRTAGHEVCVAAQPGVADAVVRSGMPVCTVGASFDLFAG
LGRAQEVMREETGRSLAGFGEMSAIPEDVRRRYVAARNAAHTGAAVAMADELIAFARSWR
PDVIVCDVVALVGPLVAEVLGVPLVYQAWGPQLPAMVRFPGHGAPVDSWPAELRALYERF
GATPRAVGGVLTVDPCPPSLHVHELPNQLVTRFVPYNGSTVVPDWLRTPPERPRVGVSWS
VSNFAHLSGQKPPLAVVVEALEGLGADVVVTAAAQDRAALGPVPPGVRVEEGLPLNLVAA
TCSVAVNHAGAGTMLTVAAAGVPQVMLPQEPGQLRNAETVAAVGAGTLIRGPQTDPVRIR
AAVQALLAERHWAEAARKLRDENAAQTTPAEAARVIAELVAARE
selected fasta
>putative glycosyltransferase [ChlC6]
GTGCTGTTCATTCCCCTGGCCGTGGCCAGCCACTACTACCCGATGGTGCCGCTGGCGTGG
GCCCTGCGGACCGCGGGACACGAGGTGTGCGTCGCGGCCCAGCCCGGCGTCGCCGACGCC
GTGGTCCGATCCGGCATGCCGGTCTGCACGGTGGGCGCCTCCTTCGACCTGTTCGCCGGG
CTCGGCAGGGCCCAGGAGGTGATGCGCGAGGAGACCGGCCGCAGCCTCGCCGGATTCGGC
GAGATGAGCGCGATCCCCGAAGACGTGCGCCGGCGCTATGTGGCCGCGCGCAACGCCGCC
CACACCGGCGCCGCCGTCGCGATGGCCGACGAACTGATCGCGTTCGCCCGGTCCTGGCGC
CCCGATGTGATCGTCTGCGATGTGGTGGCCCTGGTGGGCCCGCTGGTCGCCGAGGTGCTG
GGCGTCCCCCTCGTCTACCAGGCCTGGGGGCCGCAGCTCCCGGCCATGGTCCGCTTCCCG
GGGCACGGCGCGCCGGTGGACTCCTGGCCCGCGGAACTGCGAGCGCTGTACGAGCGGTTC
GGCGCCACGCCGCGCGCCGTCGGCGGGGTCCTCACGGTCGACCCGTGTCCGCCGAGCCTG
CATGTGCACGAGCTGCCCAACCAGTTGGTCACCCGGTTCGTGCCGTACAACGGCTCCACG
GTGGTCCCCGACTGGCTGCGTACACCACCGGAGCGGCCGCGCGTCGGGGTGTCGTGGAGC
GTGTCCAACTTCGCGCACCTGTCCGGCCAGAAGCCGCCGCTCGCCGTGGTGGTGGAGGCC
CTGGAGGGGCTGGGCGCCGACGTGGTCGTCACCGCGGCGGCCCAGGACCGCGCGGCGCTC
GGCCCCGTCCCGCCCGGCGTACGGGTGGAGGAGGGGCTGCCGCTCAATCTGGTCGCCGCG
ACCTGCTCGGTCGCCGTCAACCACGCGGGCGCCGGCACCATGCTGACCGTCGCGGCCGCC
GGCGTGCCCCAGGTGATGCTGCCCCAGGAGCCGGGCCAGCTGCGCAACGCCGAGACCGTG
GCCGCCGTCGGGGCGGGCACCCTGATCCGCGGCCCGCAGACCGACCCGGTGCGGATTCGC
GCGGCCGTCCAGGCCCTGCTCGCCGAACGGCACTGGGCGGAGGCCGCCCGGAAGCTGCGC
GACGAGAACGCGGCCCAGACCACCCCCGCCGAGGCCGCCCGGGTGATCGCGGAGCTGGTC
GCCGCACGGGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [9-154]  3.5e-13 PF03033
PF03033   Glyco_transf_28
IPR007235 Glycosyl transferase, family 28, C-terminal (Domain)
 [300-374]  6e-08 PF04101
PF04101   Glyco_tran_28_C
IPR010610 Domain of unknown function DUF1205 (Domain)
 [193-288]  1.69999999999999e-26 PF06722
PF06722   DUF1205
SignalP
 [1-21]  0.723 Signal
Eukaryota   
TMHMM No significant hit