close all open/close all

CDS information : Chth_00260


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction31,481 / 45,580 / + [in whole cluster]
31,481 / 45,580 / + [in contig]
Location31481..45580 [in whole cluster]
31481..45580 [in contig]
TypeCDS
Length14,100 bp (4,699 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)ChlA1
Gene
Gene (GenBank)chlA1
EC number
Keyword
Note
Note (GenBank)
  • type I PKS
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)

close this sectionPKS/NRPS Module

A0 malonyl-CoA
1 methylmalonyl-CoA
2 malonyl-CoA
KSQ44..418
AT588..913
ACP994..1064
KS1087..1462
AT1638..1956
DH2005..2181
KR2506..2686
ACP2802..2872
KS2894..3270
AT3425..3736
DH3785..3949
KR4248..4429
ACP4537..4607

close this sectionSequence

selected fasta
>polyketide synthase [ChlA1]
MCGRRALALRPSGAGRHTGTEKVAHTAMSSLGNHASCDADELSRSIAVVGLSCRLPQASG
PEEFWRLLSTGSSAVTRTLGARWAEETGLAPGTGATAAAGIEHGGVLDRVDGFDAGFFGI
SPREATEMDPQQRLTLELSWEALEDAAIVPGTLRSGAGGVFVGAIGDDYAALLARHRPRE
FTPHTLTGTSRGLLAGRVSYTLGLHGPSLTVDAAQSSSLVAVHLACESLRGGECDLALAG
GVNLIIGPESTARTAAFGALSPDGRCYTFDARANGYVRGEGGAVVVLKPLARALADGDRI
HCVIRGSAVNNDGASEALTVPSGRAQAEVVRRACARAGIAPDEVQYVELHGTGTRVGDPV
EAAALGSVYGAGRTRSTALRVGSAKTNVGHLEGAAGITGLVKTVLSIAHRRLVPSLHFRS
PHPDIDLDALRLRVQTETGPWPAPDLPLVAGVSSFGMGGTNCHVILAEAPAARGGEADGE
GGEGCGSTPVARDAGVALPVLVSARDGEALRGQAAALESWLRKRPDARIADIGWSLASTR
TAFEHRAVVLGQDREALLAGLRGLADGMPGAGVVQGRTAAGPGALAVLFTGQGSQYAGMG
CELHRAYPAFARAFDEVCAHLDPLLEQPLRQVVFADEGSAEAGLLHRTSFTQAALFAVET
ALFRLFEHWGVTPQVVVGHSIGELTAAHVAGVLSLPDAAALVAARGRLMEALPEGGAMVA
VEASEEEVAGSVLERAGEVALAAINGPRSVVISGDEGAVTGLAEQWRERGRKVRRLQVSH
AFHSPRMEPMLAEFERVARGLDYATPHIPVVSNVTGRLAEAGQVDSPEYWVRHVREAVRF
HDGVLALREDGVTACLELGPGGVLTGMAGECLAEEEDDTAGSGRLLAATLRSGRPEPDAV
LRALARLHAHGVPVDWRSVFAPWAPRRVALPTYAFQRRRYWPEIGTGAQWPREPAETPGA
EVSAGPAAHEAASTADSWQRRLAGMTGRERERFLHELVRTQVAIALGHVTPDAVDTGRTF
KDLGFDSMSAVQLRDQLGAVTGLRLPAALLYNHPTPRTLVDRLRSELDASEATATTAPAD
PAAVSDDPVVVVGMACRFPGGVGSPEQLWDLVAQGRDAIGPLPDNRGWDLEALYDPDPET
PSTSYVREGGFLYDADLFDPAFFGISPREAAAMDPQQRLLLETSWEALERAGIDPRTLAG
TAAGVFVGATAQEYGPRLSEGAEGLDGYLLTGTTTSVTSGRVAYTLGLHGPAVTVDTACS
SSLTALHLAAQALRLGECELVLAGGVTVMAGPGMFVEFSRQRGLSPDGRCKAFAASADGT
GWAEGAGMVVLERLSDARRHGHRVLAVVRGSAINQDGASNGLAAPNGPAQEDVIRQALAA
ARLTGDEIDAVEAHGTGTKLGDPIEAEALLATYGRDRSPELPLWLGSLKSNIGHAQAAAG
VGGFIKMVMALRHGVLPGTLHADEPTPHVDWSAGTVSLLTEARPWPQTDRPRRAAVSSFG
ISGTNAHLILEQAPAESAPEEGPRGPSGAVSAGAVPSESVATGAVPPESVAAWPVSGRSE
QALAAQAGRLRDLLAAEPGLSPADVGYSLATTRTAFEERAVIVAADRAGFMDALAALARG
ESAPGVVRGRARALGRTVFVFPGQGSQWAGMALELLDSAPVFAERIEECAAAMSAYVDWS
LVDVLRGREGAPGLDRVDVVQPVLFAVMVSLAELWRSFGVRPDAVVGHSQGEIAAACVAG
ALTLDDACRVVTLRSQALVALAGTGGMVSVPLPAAEVRARLEHRRERLGVATVNGPASTV
VSGDPEALDEFLAECAADGVRARRIPVDYASHSHHVEAIRERLAELLAGIAPRSCDVAFY
STVYGEPVDTGELDAGYWYRNLRDTVEFERATRALLRDGYGVFVESSPHPVLTVGLQETI
DAVQEVAPTVVTGSLRRDEGGLRRLLASLAEIHVNGGDAHWHTVHGASAHTIELPTYAFQ
RERHWLDAPQAAGSAAGLGLSDTGHPLVAAAVEIAEEDRLVLTGRLSRRTHPWLEDHAVS
GTVVVPGAAFVELALCAAGHTDCNRLDDLTLENPLVLPERGEIRVQVAVGPPDPSGRRPV
TVHARPEAAGAEQEPDPRWTRHASGSLAASEGGPSRRSREAWPLEPGEAWPPPGATPLAI
DDLYERLLDQGYEYGPAFQGLRAAWRHGDSVYAEAALPEEQRTDGARFALHPALLDSALH
SLALGGGPLRADDQGRLQLPFSWTGFTLSTTGAQSLRVRWTATERDTVALALATSSGVPV
AAVEALALRPAAVDRLGDGRGARLGGLHQVAWTPVDAAAEAIGEQDVTFVAGAEGINAVA
AAVDEGQAAAPAFVFVSPLAEDEAPGGEGGAPPYDFAQSRTGAHRALALVHEWLAHEEAL
GGSRLVFVTREATGAAGAAGLAEAPVWGLVRCAQTEHPGRFALLDIDGPWDAGHLPVVAG
ALAAGESQLALREGVPHAPRLVRADLPRETVPAEPEPSPLTGYANGTTLITGGTGTLGRL
LARHLVTQHGARHLLLASRRGAAADGVQELVAELTELGAQVTVAACDTADRAALAALLAS
VPGEQPLTAVVHAAGVLDDGVIGSLTPERLDTVLRAKAEAAWLLHDLTRTLPLAEFVLFS
SVIGTIGGAGQANYAAANVFLDSLAHHRRALGLPARSLAWGLWEDPSGMPLSRTTGTASG
MTAGMSDADRARLARTGLVPLSAEDGLSLFDAAHATDQAAALVAVRLNAVALRASSSAGT
LPDVLRGLVRTVRRTAAATPTGANALRARLESLPEAEQEELVLTLVRGHISDVLGHGGTD
DIADERAFKDLGFDSLTAVDLRNRLAAATGVRLPATLVFDHPTPGALSRRLRAELTGSQT
ESTAPARSAIPSSDPIAITGIGCRFPGGIGSPEELWRLVSEGGEARSGFPSQRGWDLDAL
YDPDPDHPGTVYTRVGGFLYDAHHFDADFFGMSPREALATDPQQRLLLETAWETLERAGL
DPRSLRGSRTGVFTGIMYGDYGGRLQRAPEELEGYLRNGSHGSVASGRIAYTFGFEGPAV
SVDTACSSSLVALHLAAQALRNGECDLALAGGVTVMATPATFIEFSRQRGLSADGRCKAF
AASADGTGFAEGVGLLLVERLSDARRNGHRVLALLRGSAVNQDGASNGLTAPNGPSQQRV
IQAALADARLTAGQVDAVEAHGTGTSLGDPIEAQALLATYGQDREPEQPLWLGSIKSNIG
HTQAAAGVAGVIKMVQAMRHGVLPQTLHVDEPTPHVDWAAGAVALLDETRPWPETGRPRR
AAVSSFGISGTNAHVILEQAPLEESTEEAPVAVSPGGPVAWVLSAKTEGALREQAARIRD
LASGELPLADVGFSLATTRAHLEQRAAVIAEDRGGFLAGLAALASGGEHPQLVRGSAAKA
SRTAFLFAGQGSQRPGMGRELYDSQPVFAQALDDVCALLDPHLDVPLRQVMFADEDSQEA
GLLQDTLYTQPALFALETALFRLLEHLGVKPHHLVGHSIGEIAAAHAAGVLTLADACTLV
AARARLLHDLPAGGAMTALQATEAEVLTALEGNDRVAIAALNAPNSTVISGDTDTVAHIA
ATFAEQGRKVTPLHVSHAFHSPHLDPVLDDFHTVAATLTYHQPRIPIISTLTGEPAGTDD
LTTPDYWTRQLREAVRFHPAITTLDATTLIELGPDTTLTALTRSMTDAVAVPLLHPHTPE
THTLLTALATAHTHGTPIDWTTIFTPHHPTAITLPTYPFQHHPYWLHATPTPTNATALGQ
TPTTHPLLAATADLPNGVSLFTGRLSLSEHPWLADHTVLGTTILPGAALLDLALHAAHHT
GHNHVEELTLHTPLALLGHTAMRLRLTTAPTGDGDRDKTEFTLHSQPENSAHGSDWTLHA
TGTLTTTQPRQGTGHTAWPPADVTPVDVEELYRYLADLGLGYGSAFRGMSGAWRQGTTVY
AEIRLPDALSTDGHPLHPALLDAALHTVFLSTGEPKDGGAQTLLPFSWGGLTLHAARPSV
LRVRLTPAESTDGAQPSVFSLGLADGAGRPVATIESFTVRPVSARQLAASAHVDAGAELG
RIDWTPLPETYGTSSTGLTTADLTLLTVTSHGDASPAEEAHRLLHDTLARVQKWLADDDS
QGRGERLVIVTRGAMSTGSEDEVRDLAAASVWGLIRAAQTEHPGRLVLVDLGPEDAPDAQ
HLERIAGAVSGGESQLAVRGGAVLVPGVIRFAVGACDDVASRPFDASGTVLITGGTGTLG
RLLARHLVTGHGVRHLLLISRRGEAAEGAADLVAELASGGAATVSVVACDAADAIALRAV
VDAIPHERPLTAVIHAAGVLGDATVGTLTPDLVDTVLRPKVDAAWNLHQCTAHLDLAAFV
LFSSAAGSLGTAGQSAYAAANTFLDALAEQRGAQGRPGVSIAWGLWEQESGMTAALGSVD
RGRLARSGLLPMSSADGLAGFDAALSPERDRAVVLAARWDLAALQRQVVSGELPPLLRGL
VRSPAALPVALASPAEAASALREQLAALAEPERAEALLDVVRTHAAAVLGLASPALVEPG
RGFLDMGFDSLTAVELRNRLSTATGLRLPATLLFDHPAPASLARHLYDAFGPGDSTAHHA
VLIELDKLEASFDALSEDSRTVLALRLRDTLLRLSQAAGSDARSPAGPEGSSGPAVTARI
ESASDDEVFAFIDNELGIA
selected fasta
>polyketide synthase [ChlA1]
GTGTGCGGCCGCCGCGCGCTCGCTCTCCGTCCGAGTGGCGCCGGCCGGCACACGGGGACA
GAAAAGGTGGCGCACACAGCGATGTCGAGCCTCGGCAATCACGCGTCCTGCGACGCGGAC
GAACTCTCCCGTTCCATCGCGGTCGTCGGACTGTCCTGCCGCCTCCCCCAGGCATCCGGC
CCGGAGGAGTTCTGGCGGCTGCTGTCCACGGGGTCGAGCGCCGTCACACGGACGCTCGGC
GCGCGCTGGGCCGAGGAGACGGGACTCGCGCCCGGCACCGGGGCGACGGCCGCCGCGGGG
ATCGAACACGGCGGCGTCCTGGACCGTGTCGACGGTTTCGACGCCGGGTTCTTCGGCATC
TCCCCGCGCGAGGCGACGGAGATGGACCCCCAGCAGCGGCTGACGCTCGAACTGAGCTGG
GAGGCGCTGGAGGACGCGGCCATCGTGCCGGGGACCCTGCGCTCCGGGGCCGGCGGGGTC
TTCGTGGGCGCCATCGGCGACGACTACGCGGCGCTGCTCGCCCGCCACCGCCCGCGCGAG
TTCACCCCGCACACCCTGACCGGCACCAGCCGGGGTCTGCTGGCCGGCCGCGTCTCGTAC
ACCCTCGGGCTGCACGGCCCCAGTCTCACCGTGGACGCCGCCCAGTCCTCGTCGCTGGTC
GCCGTCCACCTCGCCTGCGAGAGCCTGCGCGGCGGCGAGTGCGACCTCGCCCTCGCCGGT
GGCGTCAACCTCATCATCGGACCCGAGAGCACCGCCAGAACCGCCGCGTTCGGCGCCCTG
TCTCCGGACGGCCGGTGCTATACGTTCGACGCCCGCGCCAACGGTTACGTACGCGGTGAG
GGCGGCGCCGTGGTGGTGCTCAAGCCGCTGGCCCGGGCGCTCGCCGACGGCGACCGTATC
CACTGCGTGATCCGGGGCAGCGCGGTCAACAACGACGGGGCGTCCGAGGCGCTGACCGTG
CCCAGCGGCCGGGCCCAGGCGGAGGTGGTGCGCCGCGCCTGCGCGCGTGCCGGGATCGCG
CCGGACGAGGTGCAGTACGTGGAGCTGCACGGCACCGGAACCCGGGTCGGCGACCCCGTG
GAGGCGGCGGCACTCGGTTCCGTCTACGGCGCCGGCCGGACCCGGAGCACGGCGCTGCGG
GTGGGCTCCGCGAAGACCAACGTCGGTCATCTGGAGGGCGCGGCGGGCATCACCGGCCTC
GTCAAGACGGTGCTGAGCATCGCGCACCGGCGTCTGGTGCCGTCCCTCCACTTCCGTTCG
CCGCACCCCGACATCGACCTCGACGCGCTGCGGCTGCGCGTGCAGACGGAGACCGGCCCA
TGGCCCGCGCCGGACCTGCCGCTCGTCGCCGGTGTCAGCTCTTTCGGCATGGGCGGCACG
AATTGCCATGTCATCCTCGCCGAGGCACCGGCGGCGCGGGGTGGGGAAGCGGACGGTGAG
GGCGGTGAGGGCTGCGGCTCGACGCCAGTCGCACGGGATGCGGGGGTTGCGCTGCCCGTC
CTCGTCTCCGCCCGGGACGGCGAGGCCTTGCGCGGCCAAGCGGCCGCTCTGGAGAGCTGG
TTGCGCAAGCGGCCCGACGCCCGGATCGCGGACATCGGCTGGTCCCTCGCCTCGACGCGT
ACGGCCTTCGAGCACCGGGCCGTCGTACTGGGCCAGGACCGCGAGGCGCTGCTGGCGGGC
CTGCGCGGCCTGGCCGACGGCATGCCCGGGGCGGGCGTCGTGCAGGGTCGGACCGCCGCC
GGACCCGGCGCCCTGGCCGTGCTGTTCACCGGGCAGGGCAGTCAATACGCGGGCATGGGC
TGCGAACTCCACCGCGCGTACCCCGCCTTCGCCCGCGCCTTCGACGAGGTGTGCGCCCAT
CTGGACCCACTGCTCGAACAGCCGCTGCGGCAGGTGGTGTTCGCGGACGAGGGCAGCGCC
GAGGCCGGCCTGCTGCACCGGACCTCTTTCACGCAGGCCGCGCTGTTCGCGGTCGAGACC
GCGCTGTTCCGGCTCTTCGAGCACTGGGGGGTGACCCCGCAGGTCGTGGTCGGCCATTCC
ATCGGTGAGCTGACCGCCGCCCATGTCGCCGGGGTGCTGTCCCTCCCGGACGCCGCCGCG
CTCGTGGCCGCGCGCGGCCGGCTGATGGAGGCGCTGCCAGAGGGCGGCGCCATGGTCGCC
GTCGAGGCGTCCGAGGAGGAGGTCGCCGGGAGCGTCCTCGAACGGGCGGGCGAGGTAGCG
CTCGCGGCGATCAACGGCCCCCGGTCCGTGGTGATCTCGGGCGACGAGGGGGCCGTGACC
GGGCTGGCCGAGCAGTGGCGGGAGCGGGGGCGGAAGGTACGGCGGCTCCAGGTCAGCCAC
GCGTTCCACTCCCCGCGCATGGAGCCGATGCTGGCCGAGTTCGAGCGGGTCGCGCGAGGG
CTCGACTATGCGACGCCGCACATTCCGGTCGTCTCCAATGTCACCGGGCGCCTCGCGGAA
GCGGGACAGGTGGACTCGCCCGAGTACTGGGTGCGTCATGTGCGCGAGGCGGTGCGTTTC
CACGACGGCGTCCTGGCCCTGCGGGAGGACGGGGTCACGGCCTGCCTGGAGCTGGGCCCC
GGGGGCGTCCTCACGGGCATGGCCGGGGAGTGCCTGGCCGAGGAGGAGGACGACACGGCC
GGCTCCGGCAGGCTGCTCGCCGCCACCCTGCGATCCGGCCGGCCTGAGCCCGATGCGGTC
CTCCGGGCGCTCGCCCGCCTGCACGCGCACGGGGTGCCGGTGGACTGGCGGTCCGTCTTC
GCCCCTTGGGCTCCGCGCCGGGTCGCGTTGCCGACGTACGCGTTTCAGCGGCGCCGGTAC
TGGCCGGAGATCGGGACGGGGGCGCAGTGGCCCCGGGAACCCGCAGAGACGCCGGGTGCC
GAAGTCTCGGCGGGCCCGGCCGCACACGAGGCCGCGAGTACGGCGGACTCCTGGCAACGC
CGGCTCGCGGGCATGACCGGACGGGAGCGCGAGCGCTTCCTCCACGAGCTGGTGCGCACC
CAAGTGGCCATAGCCCTGGGGCATGTGACGCCGGACGCGGTCGACACGGGCCGTACGTTC
AAGGACCTCGGCTTCGACTCGATGTCGGCGGTGCAACTGCGCGACCAGCTCGGCGCGGTC
ACCGGTCTGCGCCTGCCCGCCGCCCTGCTCTACAACCACCCCACCCCGCGCACGCTGGTC
GACCGGCTGCGGTCCGAACTCGACGCCTCCGAGGCGACGGCCACCACCGCACCGGCGGAT
CCCGCGGCGGTGTCCGACGACCCGGTCGTCGTCGTGGGCATGGCCTGCCGCTTCCCCGGC
GGGGTGGGCTCGCCCGAGCAGTTGTGGGACCTGGTGGCGCAGGGCCGGGACGCGATCGGC
CCGCTGCCGGACAACCGGGGCTGGGATCTGGAGGCGCTCTACGATCCCGACCCCGAGACG
CCCAGCACCTCCTACGTCCGGGAGGGCGGGTTCCTCTACGACGCCGACCTGTTCGACCCG
GCGTTCTTCGGCATCAGCCCGCGTGAGGCCGCCGCCATGGACCCGCAGCAGCGGCTGCTG
CTGGAGACGTCCTGGGAGGCGCTGGAGCGCGCCGGCATCGACCCGCGGACCCTCGCGGGC
ACGGCGGCCGGGGTGTTCGTCGGTGCCACCGCCCAGGAGTACGGGCCGCGGCTGTCCGAG
GGTGCCGAGGGGCTGGACGGCTATCTCCTGACCGGCACCACCACCAGCGTCACCTCGGGC
CGGGTCGCCTACACCCTCGGGCTGCACGGGCCCGCCGTCACCGTGGACACCGCGTGCTCG
TCGTCCCTCACCGCGCTGCATCTCGCGGCGCAGGCGCTGCGGCTCGGCGAGTGCGAGCTG
GTGCTGGCCGGCGGGGTCACGGTGATGGCCGGGCCGGGCATGTTCGTGGAGTTCAGCCGC
CAGCGCGGGCTGTCCCCCGACGGACGGTGCAAGGCCTTCGCGGCGTCGGCCGACGGCACC
GGATGGGCCGAGGGCGCCGGCATGGTGGTGCTGGAGCGGCTCTCCGACGCGCGGCGCCAC
GGCCATCGGGTCCTCGCCGTCGTCCGGGGCTCCGCGATCAACCAGGACGGGGCGAGCAAC
GGCCTCGCGGCCCCCAACGGCCCCGCCCAAGAGGACGTGATCCGGCAGGCGCTGGCCGCG
GCCCGCCTCACCGGCGACGAGATCGACGCGGTGGAGGCCCACGGCACGGGTACGAAGCTG
GGCGACCCCATCGAGGCGGAGGCGCTGCTGGCCACGTACGGCCGGGACCGGAGCCCCGAA
CTCCCGCTCTGGCTGGGCTCGTTGAAGTCAAACATCGGGCACGCCCAGGCGGCGGCCGGG
GTGGGCGGCTTCATCAAGATGGTCATGGCCCTACGTCATGGCGTGCTGCCCGGAACCCTG
CACGCCGACGAGCCGACGCCGCACGTCGACTGGTCGGCAGGCACGGTCTCGCTGCTCACC
GAGGCCCGGCCGTGGCCGCAGACCGATCGTCCGCGCAGGGCGGCGGTGTCCTCGTTCGGC
ATCAGCGGCACCAACGCCCATCTCATCCTGGAGCAGGCCCCGGCGGAGAGCGCCCCTGAG
GAGGGCCCGCGGGGTCCGTCGGGAGCGGTGTCGGCGGGAGCCGTACCGTCGGAATCGGTT
GCGACAGGAGCGGTGCCGCCGGAATCGGTGGCGGCATGGCCGGTCTCCGGGCGGTCCGAA
CAGGCCCTCGCCGCGCAGGCCGGGCGGCTGCGCGACCTGCTCGCCGCCGAGCCTGGGCTC
TCCCCCGCCGACGTCGGATACTCCTTGGCCACGACCCGCACGGCCTTCGAGGAGCGCGCC
GTCATCGTGGCCGCGGACCGCGCCGGATTCATGGACGCCCTCGCGGCGCTCGCGCGCGGC
GAATCGGCACCCGGGGTGGTGCGGGGCCGGGCCCGCGCTCTGGGCAGGACCGTGTTCGTC
TTCCCCGGACAGGGCTCCCAGTGGGCCGGTATGGCGCTCGAACTGCTGGACAGCGCCCCG
GTGTTCGCCGAGCGGATCGAGGAGTGCGCGGCGGCGATGTCGGCGTACGTCGACTGGTCG
CTCGTCGATGTGCTGCGAGGCCGCGAGGGCGCTCCGGGCCTGGACCGCGTCGACGTGGTG
CAACCCGTGCTGTTCGCCGTGATGGTGTCGCTCGCCGAACTCTGGCGGTCCTTCGGGGTG
CGGCCCGACGCGGTCGTGGGCCATTCCCAGGGCGAGATCGCCGCGGCCTGCGTCGCCGGC
GCGCTGACGCTCGACGACGCCTGCCGCGTCGTCACCCTGCGCAGCCAGGCGCTGGTCGCC
CTCGCCGGGACCGGTGGCATGGTCTCCGTGCCGCTGCCCGCCGCCGAGGTACGCGCCCGC
CTGGAGCACCGGCGGGAGCGTCTGGGCGTGGCCACCGTGAACGGGCCCGCCTCCACGGTC
GTATCGGGTGATCCGGAGGCTCTGGACGAGTTTCTGGCGGAGTGTGCCGCGGACGGGGTG
CGGGCCCGGCGGATCCCCGTCGACTACGCGTCGCACTCGCACCATGTCGAGGCGATCCGG
GAGCGGCTCGCGGAGCTGCTGGCCGGGATCGCGCCCCGCTCCTGCGACGTCGCCTTCTAC
TCGACGGTGTACGGGGAGCCGGTCGACACCGGGGAACTCGACGCCGGCTACTGGTACCGC
AATCTGCGCGATACCGTGGAGTTCGAGCGCGCCACCCGGGCCCTGCTGCGCGACGGGTAC
GGGGTGTTCGTCGAGTCCAGCCCGCATCCCGTGCTCACGGTGGGCCTCCAGGAGACGATC
GACGCGGTCCAGGAGGTGGCACCGACCGTCGTGACCGGCTCCCTGCGCCGGGACGAGGGC
GGCCTGCGACGGCTCCTCGCCTCCCTCGCCGAGATCCACGTCAACGGCGGGGACGCGCAC
TGGCACACCGTCCACGGCGCGTCGGCCCACACGATCGAGCTGCCCACTTACGCCTTCCAG
CGCGAACGGCACTGGCTCGACGCGCCGCAGGCGGCCGGATCCGCCGCGGGCCTCGGTCTG
TCCGACACCGGGCACCCGCTGGTCGCCGCCGCGGTGGAGATCGCCGAGGAGGACCGCCTC
GTTCTCACCGGGCGCCTCTCCCGAAGGACCCACCCCTGGCTGGAGGACCACGCGGTGTCC
GGGACCGTGGTCGTGCCGGGCGCCGCCTTCGTCGAACTCGCCCTGTGCGCCGCCGGGCAC
ACCGACTGCAACCGCCTCGACGATCTCACCCTGGAGAACCCGCTGGTGCTGCCCGAGCGG
GGGGAGATCCGGGTGCAGGTGGCGGTGGGCCCGCCGGACCCGTCCGGGCGGCGCCCGGTC
ACGGTGCACGCGCGGCCGGAAGCGGCCGGTGCCGAGCAGGAACCTGACCCGCGCTGGACG
CGGCATGCGAGCGGATCGCTGGCCGCGAGCGAGGGCGGCCCGTCCCGGCGATCGCGGGAG
GCATGGCCTTTGGAGCCTGGCGAAGCGTGGCCGCCGCCGGGTGCGACTCCGCTCGCGATC
GACGACCTGTACGAACGCCTGCTGGACCAGGGCTACGAGTACGGGCCGGCGTTCCAAGGG
CTGCGGGCCGCCTGGCGGCACGGCGACAGCGTGTACGCGGAGGCGGCGCTCCCCGAGGAG
CAGCGAACGGACGGCGCGCGGTTCGCTCTGCATCCCGCGCTCCTCGACTCCGCGCTGCAC
TCGCTGGCGCTCGGCGGTGGCCCGCTCCGCGCGGACGACCAGGGCCGACTTCAGCTCCCC
TTCTCCTGGACGGGATTCACCCTGAGCACCACCGGCGCGCAGTCCCTGCGGGTGCGATGG
ACGGCGACGGAGCGGGACACCGTGGCCCTCGCCCTCGCCACGTCCTCGGGAGTTCCCGTC
GCGGCCGTCGAGGCACTGGCCCTGCGCCCCGCGGCTGTGGACCGGCTCGGGGACGGGCGG
GGAGCGCGCCTCGGGGGCCTGCACCAGGTGGCGTGGACGCCGGTGGACGCGGCTGCGGAG
GCCATCGGGGAGCAGGACGTCACGTTCGTCGCGGGAGCGGAGGGGATCAATGCTGTCGCG
GCTGCGGTCGATGAGGGTCAGGCGGCGGCACCGGCGTTTGTGTTCGTGTCGCCCCTGGCG
GAGGACGAGGCGCCAGGTGGAGAGGGCGGGGCCCCGCCTTACGACTTCGCGCAGTCGCGG
ACGGGCGCCCATCGAGCGCTCGCCCTGGTCCACGAGTGGCTGGCGCACGAGGAGGCGCTC
GGCGGGTCCCGGCTGGTGTTCGTCACCCGCGAGGCGACCGGCGCGGCGGGTGCCGCAGGG
CTCGCCGAGGCACCTGTATGGGGCCTGGTCCGCTGCGCGCAGACCGAGCACCCGGGCCGC
TTCGCTCTGCTGGACATCGACGGGCCGTGGGACGCCGGACATCTGCCGGTGGTGGCAGGC
GCGCTCGCGGCCGGCGAGTCCCAGCTGGCGCTGCGCGAGGGCGTGCCCCACGCGCCACGG
CTCGTCCGGGCCGACCTGCCGCGGGAGACCGTGCCCGCCGAGCCGGAGCCGTCCCCGCTG
ACCGGATATGCGAACGGCACCACCCTCATCACCGGCGGCACCGGAACCCTCGGCAGGCTC
CTCGCCCGGCACCTCGTCACCCAGCACGGCGCCCGCCACCTGCTGTTGGCGAGCCGCCGG
GGCGCCGCCGCCGACGGTGTTCAGGAGCTGGTCGCGGAACTGACGGAACTCGGCGCCCAG
GTCACGGTGGCCGCCTGCGACACGGCGGACCGCGCTGCGCTGGCCGCACTGCTCGCGTCC
GTGCCGGGCGAGCAGCCGCTGACCGCCGTCGTCCACGCGGCCGGTGTCCTCGACGACGGC
GTCATCGGCTCCCTCACCCCGGAACGGCTGGACACCGTCCTGCGGGCCAAAGCCGAAGCG
GCCTGGCTGCTGCACGATCTCACCCGCACCCTCCCCCTCGCCGAATTCGTGCTCTTCTCC
TCCGTGATCGGCACCATCGGCGGCGCCGGCCAGGCCAACTACGCGGCGGCGAACGTCTTC
CTGGACTCCCTCGCCCACCACCGCCGCGCCCTGGGCCTGCCCGCGCGCTCGCTCGCGTGG
GGTCTGTGGGAGGACCCGTCCGGCATGCCCCTCAGCCGGACCACAGGCACGGCCTCCGGC
ATGACCGCCGGTATGAGCGACGCCGACCGCGCGCGTCTGGCCCGCACCGGCCTCGTGCCG
CTCTCCGCCGAAGACGGCCTGTCCCTCTTCGACGCCGCGCACGCCACGGACCAGGCCGCC
GCGCTGGTCGCGGTCCGTCTCAACGCCGTTGCGCTCCGGGCGAGTTCATCCGCCGGGACA
CTGCCCGACGTGCTGCGCGGCCTGGTACGCACCGTACGCCGCACGGCGGCCGCCACGCCC
ACCGGCGCGAACGCCCTGCGCGCCCGCCTGGAGAGCCTGCCGGAAGCCGAGCAGGAGGAA
CTGGTCCTGACGCTCGTGCGCGGACACATCTCGGACGTGCTCGGCCACGGCGGTACCGAC
GACATCGCCGACGAACGGGCCTTCAAGGACCTCGGATTCGACTCGCTCACCGCGGTGGAC
CTGCGCAACCGACTGGCCGCGGCCACCGGAGTCCGGCTGCCGGCCACGCTCGTCTTCGAC
CATCCGACCCCCGGCGCCCTGTCCCGCCGCCTGCGCGCCGAACTGACCGGTTCCCAGACC
GAGTCCACTGCCCCGGCCCGCTCGGCCATCCCCTCCTCCGACCCCATCGCGATCACCGGC
ATCGGCTGCCGCTTCCCCGGCGGCATCGGCTCCCCGGAGGAGCTGTGGCGGCTGGTCTCG
GAGGGCGGCGAGGCCCGCTCGGGCTTCCCGTCCCAACGAGGCTGGGACCTGGACGCCCTC
TACGACCCGGACCCCGACCACCCCGGGACCGTCTACACCCGTGTCGGCGGTTTCCTCTAC
GACGCCCACCACTTCGACGCCGACTTCTTCGGCATGAGCCCCCGCGAGGCCCTGGCCACC
GACCCGCAGCAACGCCTGCTGCTGGAGACCGCCTGGGAGACCCTGGAACGCGCCGGCCTC
GACCCGCGGTCCCTGCGCGGCAGCCGCACCGGCGTCTTCACCGGCATCATGTACGGCGAC
TACGGCGGCCGGCTTCAGCGGGCACCCGAGGAGCTGGAGGGCTACCTCCGCAACGGCAGC
CACGGCAGCGTCGCCTCCGGGCGCATCGCGTACACCTTCGGCTTCGAGGGCCCCGCCGTG
AGCGTCGACACGGCCTGCTCCTCCTCGCTCGTCGCCCTGCATCTGGCCGCCCAGGCGCTG
CGCAACGGCGAGTGCGACCTGGCGCTCGCGGGCGGCGTCACGGTGATGGCCACACCGGCG
ACGTTCATCGAGTTCAGCCGCCAGCGGGGCCTGTCGGCGGACGGCCGCTGCAAGGCGTTC
GCGGCCTCGGCCGACGGGACCGGCTTCGCCGAGGGCGTGGGCCTGCTCCTGGTGGAACGC
CTCTCGGACGCCCGGCGCAACGGCCACCGCGTCCTGGCGCTCCTGCGCGGCTCGGCGGTC
AATCAGGACGGCGCCAGCAACGGCCTCACCGCCCCGAACGGACCCTCACAGCAGCGGGTC
ATCCAAGCCGCACTGGCCGATGCCCGGCTCACCGCCGGGCAGGTGGACGCGGTCGAGGCG
CACGGCACGGGAACCAGTCTGGGCGACCCGATCGAGGCCCAGGCACTGCTCGCCACTTAC
GGGCAGGACCGGGAGCCTGAACAGCCGCTGTGGCTGGGCTCGATCAAGTCGAACATCGGC
CACACCCAGGCCGCCGCGGGCGTCGCCGGTGTGATCAAGATGGTCCAGGCGATGCGGCAC
GGGGTGCTGCCACAGACACTGCATGTCGATGAGCCGACTCCACATGTCGACTGGGCCGCG
GGAGCCGTGGCACTGCTCGATGAGACCCGCCCCTGGCCGGAGACGGGACGCCCGAGGCGG
GCGGCCGTGTCCTCCTTCGGTATCAGCGGGACCAACGCCCACGTGATCCTGGAACAGGCC
CCGCTTGAGGAGTCGACCGAGGAAGCACCGGTCGCTGTCTCGCCGGGTGGGCCGGTGGCG
TGGGTGCTGTCCGCCAAGACCGAGGGCGCGCTGCGGGAACAGGCGGCACGCATACGGGAC
CTGGCGAGCGGTGAGCTCCCCCTGGCGGATGTCGGCTTCTCGCTGGCCACTACCCGGGCG
CATCTGGAACAACGGGCGGCGGTGATCGCCGAGGACCGGGGAGGCTTCCTCGCCGGGCTT
GCGGCCCTGGCCTCGGGAGGTGAGCATCCGCAGCTCGTACGAGGATCAGCCGCCAAAGCC
TCCAGGACCGCGTTCCTCTTCGCCGGACAGGGCAGCCAACGCCCCGGCATGGGACGGGAG
CTGTACGACAGCCAGCCCGTCTTCGCCCAGGCCCTCGACGACGTATGCGCCCTGCTCGAC
CCGCACCTGGACGTCCCTCTTCGCCAGGTCATGTTCGCCGACGAGGACAGCCAGGAGGCC
GGACTCCTTCAGGACACGCTCTACACGCAGCCCGCGCTGTTCGCCCTGGAGACGGCGCTC
TTCCGCCTGCTTGAGCACCTGGGCGTAAAGCCGCACCACCTCGTCGGGCACTCCATCGGA
GAGATCGCCGCAGCCCACGCAGCCGGAGTGCTCACCCTCGCCGACGCCTGCACCCTGGTC
GCCGCCCGCGCCCGCCTGCTGCACGACCTCCCGGCAGGCGGCGCCATGACCGCCCTCCAG
GCCACCGAAGCCGAAGTCCTCACCGCACTGGAAGGCAACGACCGCGTCGCCATCGCCGCC
CTCAACGCCCCGAACAGCACGGTGATCTCCGGCGACACCGACACCGTCGCACACATCGCC
GCCACCTTCGCAGAGCAAGGCCGCAAGGTGACACCACTGCACGTCAGCCACGCCTTCCAC
TCCCCCCACCTCGACCCCGTCCTCGACGACTTCCACACAGTCGCCGCAACCCTCACCTAC
CACCAGCCCCGCATCCCGATCATCTCCACCCTCACCGGAGAACCCGCCGGAACCGACGAC
CTCACCACCCCCGACTACTGGACACGACAGCTCCGCGAAGCCGTCCGCTTCCACCCCGCC
ATCACCACACTCGACGCCACCACCCTCATCGAACTAGGCCCCGACACCACCCTCACCGCA
CTCACCCGCTCCATGACGGACGCCGTCGCCGTCCCTCTCCTCCACCCCCACACGCCCGAG
ACCCACACCCTCCTCACCGCCCTCGCCACCGCCCACACCCACGGCACCCCCATCGACTGG
ACCACGATCTTCACCCCCCACCACCCCACCGCCATCACCCTCCCCACCTACCCCTTCCAA
CACCACCCCTACTGGCTCCACGCCACTCCCACCCCCACCAACGCCACCGCCCTCGGCCAA
ACCCCCACCACTCACCCCCTCCTGGCCGCAACGGCCGATCTCCCCAACGGAGTCAGTCTG
TTCACGGGCCGCCTCTCCCTCAGCGAGCACCCCTGGCTGGCAGACCACACCGTTCTCGGC
ACGACGATCCTCCCCGGCGCCGCCCTCCTCGACCTCGCCCTCCACGCCGCCCATCACACC
GGCCACAACCACGTCGAAGAGCTCACCCTCCACACACCCCTCGCGCTCCTCGGACACACG
GCGATGCGACTCCGTCTCACCACCGCACCCACCGGCGACGGTGACCGGGACAAGACGGAG
TTCACCCTGCATTCCCAGCCCGAGAACTCCGCGCACGGCTCCGACTGGACCCTTCACGCG
ACGGGCACCCTCACCACCACTCAGCCCCGCCAAGGAACCGGCCACACCGCCTGGCCGCCG
GCCGACGTCACACCGGTCGATGTCGAGGAGTTGTACCGTTACCTCGCCGATCTAGGACTG
GGCTATGGTTCGGCCTTCCGGGGGATGAGCGGCGCCTGGCGCCAAGGCACCACCGTCTAT
GCCGAGATCCGCCTCCCCGACGCACTCTCCACCGACGGCCATCCGCTCCACCCCGCGCTG
CTGGACGCCGCCCTGCACACGGTCTTCCTCAGCACCGGGGAGCCGAAGGACGGAGGCGCA
CAGACACTGCTCCCCTTCTCCTGGGGCGGGTTGACCCTTCACGCCGCCCGGCCTTCCGTG
CTCCGTGTGCGGCTGACGCCCGCCGAGTCCACCGACGGCGCCCAACCCTCCGTATTCTCG
TTGGGGTTGGCGGATGGGGCAGGCCGGCCGGTAGCCACGATCGAGTCGTTCACCGTGCGC
CCCGTCTCGGCACGACAGCTGGCGGCCTCCGCACACGTCGACGCGGGCGCCGAGCTGGGC
CGTATCGACTGGACGCCGCTCCCGGAGACGTACGGCACGAGCAGCACGGGCCTCACGACC
GCCGACCTGACTCTCCTGACCGTCACCTCCCATGGCGATGCCTCTCCCGCCGAGGAAGCG
CACCGGCTGCTGCACGACACACTCGCGCGGGTTCAGAAGTGGCTCGCGGACGACGACAGC
CAAGGGCGTGGCGAACGCCTGGTGATCGTGACCCGGGGAGCCATGTCCACCGGGAGCGAG
GACGAGGTCCGGGATCTGGCGGCCGCCTCGGTGTGGGGTCTCATCCGCGCGGCTCAGACG
GAGCACCCCGGCCGCCTGGTCCTCGTAGACCTCGGTCCCGAGGACGCCCCCGACGCTCAG
CATCTGGAGCGGATCGCCGGCGCGGTATCCGGTGGCGAGTCCCAGCTGGCCGTGCGCGGC
GGCGCGGTCCTCGTTCCCGGGGTGATCCGTTTCGCTGTCGGCGCTTGCGACGACGTCGCG
AGCCGCCCGTTCGACGCGTCGGGCACCGTCCTCATCACCGGAGGCACCGGAACCCTCGGC
CGTCTGCTGGCCCGGCATCTGGTCACGGGGCACGGCGTACGGCATCTGCTGCTGATCAGT
CGTCGCGGCGAGGCCGCCGAGGGGGCCGCCGACCTCGTGGCGGAGCTGGCCTCCGGCGGC
GCCGCCACGGTGTCCGTGGTGGCCTGCGACGCCGCTGATGCCATCGCTCTGCGGGCGGTC
GTCGATGCGATTCCGCACGAGCGCCCCCTCACCGCCGTGATCCACGCGGCGGGTGTGCTC
GGCGACGCCACCGTCGGCACACTGACGCCCGACCTGGTGGACACCGTGCTGCGCCCCAAG
GTGGACGCGGCCTGGAATCTCCACCAGTGCACGGCGCACCTGGATCTCGCGGCCTTCGTC
CTCTTCTCGTCGGCCGCCGGAAGCCTCGGTACCGCGGGTCAGTCGGCCTACGCGGCCGCC
AACACATTCCTCGACGCCCTGGCCGAGCAGCGCGGGGCCCAGGGCCGGCCGGGCGTGTCG
ATCGCCTGGGGTCTGTGGGAGCAGGAGAGCGGAATGACCGCGGCCCTCGGCAGCGTCGAC
CGCGGCCGGCTCGCCCGGTCCGGTCTGCTGCCCATGAGCAGCGCGGACGGTCTCGCGGGC
TTCGACGCGGCGCTCTCGCCCGAGCGGGACCGAGCGGTCGTCCTGGCGGCGCGCTGGGAC
CTCGCCGCCCTCCAGCGTCAGGTCGTGTCCGGCGAACTGCCGCCGCTGCTGCGCGGTCTC
GTCCGCAGCCCGGCCGCCCTCCCCGTCGCGCTCGCGAGCCCGGCCGAGGCGGCCTCGGCC
CTCCGGGAGCAGCTGGCAGCCCTGGCGGAACCGGAGCGCGCCGAGGCGCTGCTCGACGTG
GTGCGGACGCACGCCGCGGCCGTACTGGGTCTCGCTTCACCCGCTCTGGTCGAGCCGGGA
CGCGGCTTCCTCGACATGGGCTTCGACTCGCTCACCGCGGTCGAGCTCCGCAACCGTCTC
AGCACCGCCACCGGGCTGCGCCTGCCCGCCACGCTCCTCTTCGACCACCCGGCACCGGCT
TCGCTCGCGAGGCATCTGTACGACGCGTTCGGGCCCGGAGATTCGACGGCCCACCACGCC
GTACTGATCGAACTGGACAAGCTGGAAGCCTCATTTGACGCACTGTCGGAGGACTCGCGG
ACCGTCCTCGCCCTCCGGCTGCGGGACACCCTTCTGAGGCTCAGTCAGGCCGCCGGGTCC
GATGCCCGGTCCCCGGCCGGCCCCGAGGGCTCCTCGGGTCCGGCCGTCACGGCACGCATC
GAGTCGGCGAGCGACGACGAGGTCTTCGCCTTCATCGACAACGAGCTCGGAATCGCCTAA
[0] KSQ44..418
[0] AT588..913
[0] malonyl-CoA780..784
[0] ACP994..1064
[1] KS1087..1462
[1] AT1638..1956
[1] methylmalonyl-CoA1829..1833
[1] DH2005..2181
[1] KR2506..2686
[1] ACP2802..2872
[2] KS2894..3270
[2] AT3425..3736
[2] malonyl-CoA3617..3621
[2] DH3785..3949
[2] KR4248..4429
[2] ACP4537..4607
[0] KSQ130..1254
[0] AT1762..2739
[0] malonyl-CoA2338..2352
[0] ACP2980..3192
[1] KS3259..4386
[1] AT4912..5868
[1] methylmalonyl-CoA5485..5499
[1] DH6013..6543
[1] KR7516..8058
[1] ACP8404..8616
[2] KS8680..9810
[2] AT10273..11208
[2] malonyl-CoA10849..10863
[2] DH11353..11847
[2] KR12742..13287
[2] ACP13609..13821

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [578-712]  G3DSA:3.40.366.10 [780-903]  G3DSA:3.40.366.10 [1633-1761]  G3DSA:3.40.366.10 [1829-1947]  G3DSA:3.40.366.10 [3414-3550]  G3DSA:3.40.366.10 [3617-3727]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1022-1037]  PS00012 [2830-2845]  PS00012 [4565-4580]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [994-1064]  PS50075 [2802-2872]  PS50075 [4537-4607]  PS50075
PS50075   ACP_DOMAIN
 [998-1063]  1.4e-09 PF00550 [2806-2871]  1.6e-12 PF00550 [4540-4606]  5.59999999999999e-11 PF00550
PF00550   PP-binding
 [987-1103]  3.60000433965927e-25 SSF47336 [2795-2910]  1.29999924468179e-28 SSF47336 [4528-4614]  3.39999972437717e-22 SSF47336
SSF47336   ACP_like
 [993-1067]  7.20000000000003e-62 G3DSA:1.10.1200.10 [2801-2876]  7.20000000000003e-62 G3DSA:1.10.1200.10 [4535-4609]  7.20000000000003e-62 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [2506-2685]  3.5e-61 PF08659 [4248-4428]  4.70000000000003e-59 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [44-292]  1.10000000000001e-80 PF00109 [1087-1337]  4.09999999999995e-99 PF00109 [2894-3144]  6.29999999999998e-98 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [302-418]  2.19999999999997e-39 PF02801 [1345-1462]  1.2e-44 PF02801 [3153-3270]  2.8e-48 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [588-913]  3.60000000000002e-61 PF00698 [1638-1956]  1.29999999999998e-109 PF00698 [3425-3736]  6.20000000000009e-65 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [584-890]  1.19999063421924e-69 SSF52151 [1636-1950]  6.4999795054176e-69 SSF52151 [3422-3724]  1.39999277195148e-66 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [714-779]  2.90000354677981e-18 SSF55048 [1763-1828]  1.20000117458134e-18 SSF55048 [3552-3616]  2.00000075217457e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [44-304]  G3DSA:3.40.47.10 [305-471]  G3DSA:3.40.47.10 [1089-1349]  G3DSA:3.40.47.10 [1350-1516]  G3DSA:3.40.47.10 [2896-3156]  G3DSA:3.40.47.10 [3157-3322]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [43-417]  5.60004908290974e-85 SSF53901 [1079-1461]  5.60004908290974e-105 SSF53901 [2886-3268]  1e-102 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [2505-2692]  1.9e-70 G3DSA:3.40.50.720 [4248-4435]  1.9e-70 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [1250-1266]  PS00606 [3057-3073]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [588-894]  1.39999277195148e-124 SM00827 [1640-1939]  5.10003242202156e-127 SM00827 [3426-3718]  1.09999184471405e-122 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [995-1067]  1e-28 SM00823 [2803-2875]  1.60000240695997e-32 SM00823 [4538-4610]  1.60000240695997e-31 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [2005-2181]  9.49996855930963e-81 SM00826 [3785-3949]  2.19999900980707e-67 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [46-471]  SM00825 [1089-1515]  SM00825 [2896-3322]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [2506-2686]  5.20000089003336e-61 SM00822 [4248-4429]  7.40000780398343e-55 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit