close all open/close all

CDS information : Chth_00280


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction57,522 / 58,718 / + [in whole cluster]
57,522 / 58,718 / + [in contig]
Location57522..58718 [in whole cluster]
57522..58718 [in contig]
TypeCDS
Length1,197 bp (398 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)ChlE2
Gene
Gene (GenBank)chlE2
EC number
Keyword
Note
Note (GenBank)
  • cytochrome P450 hydroxylase
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)
Related Reference
ACC
A6YRR3
PmId
[19376895] Characterization of P450 FcpC, the enzyme responsible for bioconversion of diosgenone to isonuatigenone in Streptomyces virginiae IBL-14. (Appl Environ Microbiol. , 2009)
ACC
B3XWK3
PmId
[18640605] Increase in pladienolide D production rate using a Streptomyces strain overexpressing a cytochrome P450 gene. (J Biosci Bioeng. , 2008)

close this sectionSequence

selected fasta
>putative cytochrome P450 [ChlE2]
MTASEQTTDIVEGLPTARSCPFSPPDALGELRERRPIARMSYADGTLGWLITDHDLGREL
LTHPDFSSRHELRSSPVPMAIKPMPAPPGMFIGMDPPEHTRYRKPLNRHFTVRRVRELEP
AIQRIVTQHIDTMERQGPPADLVGSFALPIPVQVISELLGAEPGISEEISRLRALTLDPA
TPPEEAGAAVRATNAVMAELVRSKRRAPSDDLLGVLIADGEMTDEELTGLAFLMFIAGHE
TTANMFSLGTYLALRDDKVRAGLTGVTVLSDEAVNEFLRYLSIVQFTSRAALADVEIGGV
LVRKGETVTLSISAANRDARRFPDPDGFDFHGTENSHLAFGHGIHQCIGHNLARAELKIG
LPELFRRLPGLRLADASREVATRTGHNTYGVLELPVAW
selected fasta
>putative cytochrome P450 [ChlE2]
ATGACCGCCAGCGAACAGACCACAGACATCGTCGAGGGTCTCCCGACCGCCCGCAGCTGC
CCCTTCAGCCCGCCCGACGCCCTCGGCGAGCTGCGCGAGCGGCGTCCCATCGCGCGGATG
TCCTACGCCGATGGCACCCTGGGCTGGCTGATCACGGATCACGACCTCGGCCGCGAGCTG
CTGACCCACCCCGACTTCAGCTCCCGGCACGAGCTCAGGAGCTCTCCGGTGCCCATGGCG
ATCAAGCCGATGCCGGCCCCGCCGGGCATGTTCATCGGCATGGACCCGCCGGAGCACACC
CGCTACCGCAAGCCGCTCAACCGGCACTTCACCGTGCGCCGGGTGCGGGAGCTGGAACCC
GCGATCCAGCGGATCGTCACCCAGCACATCGACACCATGGAACGCCAGGGCCCGCCCGCC
GACTTGGTGGGCTCGTTCGCGCTGCCCATCCCGGTGCAGGTCATCTCCGAACTCCTGGGC
GCCGAGCCCGGTATCAGCGAGGAGATCTCGCGTCTGCGCGCCCTCACGCTCGATCCGGCC
ACGCCCCCGGAGGAGGCCGGCGCGGCGGTGCGCGCCACCAACGCCGTCATGGCGGAGCTC
GTCCGCAGCAAGCGCCGCGCTCCCTCGGACGACCTGCTGGGCGTGCTGATCGCCGACGGC
GAGATGACCGACGAGGAGCTGACAGGGCTGGCCTTCCTCATGTTCATCGCGGGCCACGAG
ACGACCGCGAACATGTTCAGCCTCGGCACCTATCTTGCGCTGCGGGACGACAAGGTCCGC
GCCGGACTCACGGGTGTCACCGTCCTCTCGGACGAGGCGGTCAACGAGTTCCTGCGCTAT
CTGTCGATCGTGCAGTTCACCTCACGGGCCGCACTGGCGGACGTCGAGATCGGCGGCGTT
CTGGTCAGGAAGGGCGAGACGGTGACCCTGTCCATCTCCGCGGCCAACCGGGACGCCCGG
CGCTTCCCCGACCCGGACGGATTCGACTTCCACGGCACCGAGAACAGCCATCTCGCCTTC
GGGCACGGAATCCACCAGTGCATCGGCCACAACCTGGCCCGCGCGGAGCTCAAAATCGGC
CTTCCCGAGCTGTTCAGGCGCCTTCCCGGACTTCGCCTCGCAGACGCGTCGCGGGAAGTC
GCGACCCGCACCGGACACAACACCTACGGCGTACTGGAATTACCCGTCGCCTGGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [237-254]  3.1999989904635e-06 PR00385 [272-283]  3.1999989904635e-06 PR00385 [338-347]  3.1999989904635e-06 PR00385 [347-358]  3.1999989904635e-06 PR00385
PR00385   P450
 [271-367]  1.6e-19 PF00067
PF00067   p450
 [10-398]  1.59998835313644e-86 SSF48264
SSF48264   Cytochrome_P450
 [16-398]  2.50000000000001e-96 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR002397 Cytochrome P450, B-class (Family)
 [94-105]  6.70002630158883e-48 PR00359 [141-157]  6.70002630158883e-48 PR00359 [195-217]  6.70002630158883e-48 PR00359 [272-283]  6.70002630158883e-48 PR00359 [289-316]  6.70002630158883e-48 PR00359 [317-332]  6.70002630158883e-48 PR00359 [338-347]  6.70002630158883e-48 PR00359 [347-358]  6.70002630158883e-48 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [340-349]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit