close all open/close all

CDS information : Chth_00340


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction100,441 / 99,866 / - [in whole cluster]
100,441 / 99,866 / - [in contig]
Locationcomplement(99866..100441) [in whole cluster]
complement(99866..100441) [in contig]
TypeCDS
Length576 bp (191 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)ChlL
Gene
Gene (GenBank)chlL
EC number
Keyword
Note
Note (GenBank)
  • ribosomal protein L15P
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)

close this sectionSequence

selected fasta
>hypothetical protein [ChlL]
MTVGAAAPEGLDRRALDSGQLAFQGQMPATSLVEPRDLALAAAAAAGIYDPAKDSAEEAL
KKCVIVEGLTEVIEKMAIHDEGTHGAAALAEYQDGFFDADGNRVGTVIGSARVLSMAPHM
WQYHQSRTEFEGGTFETHGVIDGTAILHGFTQIFQLTGKTGRFAGKAGFMTLTIDDPTQR
PPRYRTSFAMA
selected fasta
>hypothetical protein [ChlL]
GTGACGGTCGGCGCGGCGGCGCCGGAAGGACTCGACCGGCGGGCCCTGGATTCGGGACAG
CTCGCCTTCCAGGGGCAGATGCCCGCGACGAGCCTGGTCGAGCCCCGTGATCTCGCGCTG
GCCGCAGCGGCCGCGGCAGGGATCTACGACCCCGCCAAGGACTCGGCGGAGGAGGCGCTG
AAGAAATGCGTCATCGTCGAGGGCCTCACCGAGGTCATCGAGAAGATGGCCATCCACGAC
GAGGGAACGCACGGCGCGGCGGCGCTCGCCGAGTACCAGGACGGGTTCTTCGACGCCGAC
GGCAACCGGGTCGGCACGGTGATCGGCTCCGCGCGTGTGCTGTCCATGGCCCCGCACATG
TGGCAGTACCACCAGAGCCGCACGGAGTTCGAGGGCGGCACCTTCGAGACGCACGGCGTC
ATCGACGGCACCGCGATCCTGCACGGCTTCACCCAGATCTTCCAACTCACCGGAAAGACC
GGCCGGTTCGCGGGCAAGGCGGGCTTCATGACGCTCACCATCGACGATCCGACCCAGCGT
CCGCCGCGCTACCGGACGTCGTTCGCGATGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit