close all open/close all

CDS information : Chth_00350


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction100,612 / 101,739 / + [in whole cluster]
100,612 / 101,739 / + [in contig]
Location100612..101739 [in whole cluster]
100612..101739 [in contig]
TypeCDS
Length1,128 bp (375 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative acyltransferase
Product (GenBank)ChlM
Gene
Gene (GenBank)chlM
EC number
Keyword
  • glyceroyl-CoA
Note
Note (GenBank)
  • 3-oxoacyl-ACP synthase III
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)
Related Reference
ACC
B5L6L3
PmId
[18586939] Cloning and characterization of the tetrocarcin A gene cluster from Micromonospora chalcea NRRL 11289 reveals a highly conserved strategy for tetronate biosynthesis in spirotetronate antibiotics. (J Bacteriol. , 2008)
ACC
P68795
PmId
[11959561] Purification, characterization, and identification of novel inhibitors of the beta-ketoacyl-acyl carrier protein synthase III (FabH) from Staphylococcus aureus. (Antimicrob Agents Chemother. , 2002)

close this sectionSequence

selected fasta
>putative acyltransferase [ChlM]
MHSHGGRARSRVRQPCKPPVTPAAPGPMEEPMSDASDIYVQSAGTALPGPAVDNAALARH
FGMPKAWEEWVETFVGTRSRHFAVDLATGDIRYSLADLGETAARRALAAAGVEASRIDLV
VLGTSSPDLLMPATVNTIADRLGIDGVATYQLQSGCAGAVQALDVAVQMLRTGRHGTALV
MGADSCAKHLDVTMDAARLPPAEQINGALFGDGAGALVLSTEPSAQGVAVRHVHNRLVGL
GREPGQVIDWYGRAERGRERPPVAEDYKAIEESVPVLAADVAREVLDVLDWKETEIDYVL
PPQLSGRMTARIVARLGLTAAHEVSCITDTGNTGNALPFFQLEQLLPRMVAGDRALAVAV
ESSKWIQAGFALEKA
selected fasta
>putative acyltransferase [ChlM]
GTGCACAGCCACGGCGGGCGTGCGCGCTCTCGCGTGCGACAGCCGTGCAAGCCGCCCGTG
ACCCCGGCCGCGCCGGGGCCGATGGAGGAACCGATGAGCGACGCGTCCGACATCTACGTA
CAGTCGGCCGGCACCGCCCTGCCCGGCCCCGCCGTGGACAACGCCGCCCTGGCCCGGCAC
TTCGGGATGCCCAAGGCGTGGGAGGAGTGGGTCGAGACGTTCGTCGGCACCCGCAGCCGG
CACTTCGCGGTCGACCTCGCCACCGGTGACATCCGCTACAGCCTCGCCGATCTCGGTGAG
ACGGCCGCCCGGCGCGCCCTGGCGGCGGCCGGGGTCGAGGCGTCGCGGATCGATCTGGTG
GTGCTGGGGACCTCGTCGCCCGATCTGCTGATGCCCGCGACCGTGAACACCATCGCCGAC
CGGCTCGGCATCGACGGCGTGGCCACCTATCAGCTCCAGTCCGGGTGCGCGGGCGCCGTG
CAGGCCCTGGACGTCGCGGTGCAGATGCTGCGCACCGGACGGCACGGCACGGCCCTCGTC
ATGGGCGCCGACTCCTGCGCCAAACACCTGGACGTGACCATGGACGCGGCGCGGCTGCCC
CCGGCGGAGCAGATCAACGGCGCGTTGTTCGGCGACGGTGCCGGAGCCCTGGTGCTGAGC
ACCGAGCCGTCCGCGCAGGGCGTGGCGGTGCGCCATGTGCATAACCGGCTGGTAGGGCTC
GGCCGCGAACCGGGCCAGGTCATCGACTGGTACGGGCGGGCCGAGCGGGGACGCGAGCGG
CCACCGGTGGCCGAGGACTACAAGGCGATCGAGGAGTCCGTGCCGGTGCTCGCCGCCGAT
GTGGCCCGCGAGGTGCTCGACGTGCTCGACTGGAAGGAGACCGAGATCGACTATGTGCTG
CCGCCCCAGCTGTCGGGGCGGATGACCGCCCGGATCGTGGCCCGTCTGGGCCTGACGGCG
GCCCATGAGGTGTCGTGCATCACAGACACCGGCAACACGGGCAACGCACTGCCCTTCTTC
CAGCTCGAACAGCTGCTGCCCCGGATGGTCGCCGGGGACCGTGCGCTGGCGGTCGCAGTG
GAGTCGAGCAAGTGGATCCAGGCCGGCTTCGCACTGGAGAAGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013747 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal (Domain)
 [289-360]  3.1e-07 PF08541
PF08541   ACP_syn_III_C
IPR013751 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III (Domain)
 [152-227]  1.6e-14 PF08545
PF08545   ACP_syn_III
IPR016038 Thiolase-like, subgroup (Domain)
 [32-216]  7.4e-46 G3DSA:3.40.47.10 [217-362]  2.4e-19 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [31-229]  1e-41 SSF53901 [205-360]  6.80000200614766e-15 SSF53901
SSF53901   Thiolase-like
SignalP
 [1-23]  0.467 Signal
Bacteria, Gram-positive   
TMHMM No significant hit