close all open/close all

CDS information : Chth_00360


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction101,743 / 103,698 / + [in whole cluster]
101,743 / 103,698 / + [in contig]
Location101743..103698 [in whole cluster]
101743..103698 [in contig]
TypeCDS
Length1,956 bp (651 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productglyceroyl-ACP biosynthesis protein
1,3-bisphospho-D-glycerate phosphatase/glyceroyltransferase
Product (GenBank)ChlD1
Gene
Gene (GenBank)chlD1
EC number
Keyword
  • glyceroyl-CoA
Note
  • bifunctional protein
Note (GenBank)
  • involved in methoxymalonyl-ACP biosynthesis
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)
[18586939] Cloning and characterization of the tetrocarcin A gene cluster from Micromonospora chalcea NRRL 11289 reveals a highly conserved strategy for tetronate biosynthesis in spirotetronate antibiotics. (J Bacteriol. , 2008)

close this sectionSequence

selected fasta
>glyceroyl-ACP biosynthesis protein [ChlD1]
MTDSSTSTPAEPTLLELHRAGRLAQDYPRLPALLTGLDDAELTRAGQLLARLDPDDVLAL
HPATPTVTVAVTGHGTLAPLRAPLTAELARHGLLLRPHFGDFDSYVFDLADPGSALYRAE
PDLVLCVLDPMVVLDDLPVPWDCDDVERVARARTETAAGLAATFAETSKATLVLNTLPLP
RRYTSQLVDHRSRARLGVVWRAANTRLLRLAEAHPNVVVIDLDPLIGEGSAVSEPRLSQY
TKAHLSAALLTRYAREVGHLARLRAGHAKKVLAVDLDGTLWGGVLAEDGPDGIEAAGSYR
GEAHRAFQRVVRQLGAQGVLLTAVSKNDPEPVRQVLRDHPDMTLGEDDFVRVIANWRPKH
DNLAELAASLNVGVDSFVFVDDSPYECGLVRHELPGVAVVPVNDEPALHIEALLRDGWFD
TLELTREDVTRVAQYRDELVRKDFLDSFDSLEEYLRQLQVRVRLFPASAQDVARVSQLTL
RTNQFNQTTWRLQPAEVTALMADPAARVLVIGAADRFGDNGVVGAVFTHRDGTTLHLDNF
LLSCRVFSRGIEQTALAAVVRQAHRDGLREARAEYRATAKNGKVKDFYPRNGFTTVFDDG
TTATYRHDLTDLTGLPAFPDHVRLIESDDFGHTGSARVRLTERDHDGDDNA
selected fasta
>glyceroyl-ACP biosynthesis protein [ChlD1]
ATGACCGACTCCTCGACGTCCACCCCGGCCGAGCCCACCCTGCTCGAACTGCACCGCGCC
GGCCGCCTGGCCCAGGACTACCCCCGTCTGCCGGCCCTGCTGACCGGCCTGGACGACGCC
GAGCTGACCCGGGCCGGGCAGCTCCTGGCGCGGCTCGACCCCGACGACGTCCTGGCCCTG
CACCCCGCCACACCCACGGTGACGGTCGCCGTCACCGGGCACGGCACCCTGGCCCCGCTG
CGGGCGCCGCTCACCGCCGAACTGGCCCGCCACGGCCTGCTGTTGCGCCCCCACTTCGGC
GACTTCGACTCCTACGTCTTCGATCTGGCCGACCCCGGCAGCGCCCTGTACCGGGCCGAG
CCCGACCTGGTGCTGTGCGTGCTGGACCCGATGGTCGTCCTCGACGATCTGCCCGTGCCG
TGGGACTGCGACGACGTGGAGCGTGTGGCGCGCGCGAGGACCGAGACCGCGGCCGGGCTC
GCGGCGACCTTCGCCGAGACCTCCAAGGCGACCCTCGTCCTCAACACCCTGCCGCTGCCC
CGGCGTTACACCTCGCAGCTGGTCGACCACCGCTCCCGGGCCCGGCTCGGCGTGGTGTGG
CGGGCCGCCAACACCCGCCTGCTGCGCCTGGCCGAGGCGCACCCGAACGTGGTCGTCATC
GACCTCGATCCGCTGATCGGCGAGGGCAGCGCGGTCAGCGAGCCGCGGCTGAGCCAGTAC
ACGAAGGCCCATCTGTCGGCCGCCCTGCTGACCCGCTACGCCCGAGAGGTGGGCCATCTG
GCCAGGCTGCGGGCGGGACACGCGAAGAAGGTGCTCGCTGTCGACCTCGACGGGACGCTG
TGGGGCGGTGTCCTGGCCGAGGACGGCCCCGACGGCATCGAGGCCGCGGGCAGTTACCGG
GGCGAGGCGCACCGCGCCTTCCAGCGCGTCGTCAGACAGCTCGGTGCCCAGGGCGTGTTG
CTGACGGCGGTCAGCAAGAACGACCCCGAACCCGTGCGGCAGGTGCTCCGCGACCACCCG
GACATGACCCTGGGCGAGGACGACTTCGTCCGTGTGATCGCCAACTGGCGCCCCAAGCAC
GACAATCTCGCCGAGTTGGCGGCCTCGCTCAACGTGGGCGTGGACAGCTTCGTGTTCGTC
GACGACAGCCCCTACGAGTGCGGGCTGGTCCGGCATGAGCTGCCGGGGGTGGCGGTGGTG
CCGGTGAACGACGAGCCGGCCCTGCACATCGAGGCGCTGCTGCGCGACGGCTGGTTCGAC
ACCCTGGAGCTGACCCGTGAGGACGTCACCCGGGTCGCCCAGTACCGCGACGAGCTGGTT
CGCAAGGACTTCCTCGACAGCTTCGACTCCCTGGAGGAGTACCTGCGTCAGCTCCAGGTG
CGGGTACGGCTGTTCCCCGCCAGCGCCCAGGACGTGGCCCGGGTCTCCCAACTGACCCTG
CGCACCAACCAGTTCAACCAGACGACGTGGCGCCTGCAGCCCGCCGAGGTGACCGCCCTG
ATGGCGGACCCGGCGGCGCGGGTGCTGGTCATCGGCGCCGCCGACCGGTTCGGTGACAAC
GGCGTCGTCGGCGCCGTGTTCACCCACCGGGACGGCACCACCCTGCACCTCGACAACTTC
CTGCTGAGCTGCCGTGTCTTCTCGCGCGGCATCGAGCAGACCGCCCTGGCGGCGGTGGTG
CGGCAGGCCCACCGGGACGGCCTGCGGGAGGCTCGCGCCGAATACCGGGCCACCGCGAAG
AACGGCAAGGTCAAGGACTTCTATCCACGCAACGGCTTCACCACGGTCTTCGACGACGGC
ACCACGGCGACCTACCGGCACGACCTGACCGACCTCACCGGCCTGCCGGCCTTTCCCGAC
CACGTCCGGCTCATCGAGAGCGATGACTTCGGGCACACCGGCAGCGCCCGCGTCCGCCTC
ACCGAGCGCGACCACGACGGAGACGACAACGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000182 GNAT domain (Domain)
 [471-593]  1e-08 PF13673
PF13673   Acetyltransf_10
IPR010033 HAD-superfamily phosphatase, subfamily IIIC (Domain)
 [270-390]  4.70000000000001e-16 TIGR01681
TIGR01681   HAD-SF-IIIC
IPR010037 FkbH domain (Domain)
 [268-594]  2.79999999999994e-91 TIGR01686
TIGR01686   FkbH
IPR016181 Acyl-CoA N-acyltransferase (Domain)
 [462-605]  3.0999994589937e-10 SSF55729
SSF55729   Acyl_CoA_acyltransferase
 [463-596]  4.29999999999999e-07 G3DSA:3.40.630.30
G3DSA:3.40.630.30   Acyl_CoA_acyltransferase
IPR023214 HAD-like domain (Domain)
 [270-384]  5.8e-06 G3DSA:3.40.50.1000
G3DSA:3.40.50.1000   HAD-like_dom
 [268-427]  2.70000183580794e-10 SSF56784
SSF56784   HAD-like_dom
SignalP
 [1-40]  0.057 Signal
Bacteria, Gram-negative   
TMHMM No significant hit