close all open/close all

CDS information : Chth_00370


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction103,695 / 103,922 / + [in whole cluster]
103,695 / 103,922 / + [in contig]
Location103695..103922 [in whole cluster]
103695..103922 [in contig]
TypeCDS
Length228 bp (75 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productacyl carrier protein
Product (GenBank)ChlD2
Gene
Gene (GenBank)chlD2
EC number
Keyword
  • glyceroyl-CoA
Note
Note (GenBank)
  • discrete ACP
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)
[18586939] Cloning and characterization of the tetrocarcin A gene cluster from Micromonospora chalcea NRRL 11289 reveals a highly conserved strategy for tetronate biosynthesis in spirotetronate antibiotics. (J Bacteriol. , 2008)

close this sectionSequence

selected fasta
>acyl carrier protein [ChlD2]
MKTIDDFLVLLQDDLGLPVTHTDIGAGLDQVPGWDSVHLLSLLTLLERATGRSLPLADAL
EADSLEDIYRLAVTA
selected fasta
>acyl carrier protein [ChlD2]
GTGAAGACCATCGACGACTTCCTCGTCCTGCTCCAGGACGACCTGGGCCTTCCGGTGACG
CATACGGACATCGGCGCGGGCCTCGACCAGGTCCCCGGCTGGGACTCCGTGCACCTGCTG
TCCCTGCTGACCCTCCTCGAACGCGCCACCGGCCGCTCCCTTCCGCTGGCGGACGCGCTG
GAGGCGGACAGCCTGGAGGACATCTACCGACTCGCGGTGACGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [33-73]  PS50075
PS50075   ACP_DOMAIN
 [3-75]  1.60000065022528e-06 SSF47336
SSF47336   ACP_like
 [4-69]  0.00025 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [9-70]  0.0001 PF00550
PF00550   PP-binding
SignalP No significant hit
TMHMM No significant hit