close all open/close all

CDS information : Chth_00380


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction103,919 / 104,734 / + [in whole cluster]
103,919 / 104,734 / + [in contig]
Location103919..104734 [in whole cluster]
103919..104734 [in contig]
TypeCDS
Length816 bp (271 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative acyltransferase
Product (GenBank)ChlD3
Gene
Gene (GenBank)chlD3
EC number
Keyword
  • glyceroyl-CoA
Note
Note (GenBank)
  • pyruvate/2-oxoglutarate dehydrogenase
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)
Related Reference
ACC
B5L6L6
PmId
[18586939] Cloning and characterization of the tetrocarcin A gene cluster from Micromonospora chalcea NRRL 11289 reveals a highly conserved strategy for tetronate biosynthesis in spirotetronate antibiotics. (J Bacteriol. , 2008)

close this sectionSequence

selected fasta
>putative acyltransferase [ChlD3]
MTAPGKDPATPRPVARQRRHTLSFLEEIRSFSPVFLDTAVDMTSIREHRAAARAPGRRYS
TTAYVLHTAARVLARHPEANAAIRGRARPRIARYEGVHGKLALDRFLDGQRVVLSTVLRD
LEQTGLTGIQDRIDHFRRGDPGTMAEFAPTRALQRLPWPLRTLAFRAGTRPLGRRPAVMG
TFAVTSLGHRPVDGFYSVGGTTITLGLGSTADRPVVRDGRLGVAPLMRLSLTFDHRVIDG
AEAADVLAEIKEGLESFKDVGDEDVCTTSSS
selected fasta
>putative acyltransferase [ChlD3]
ATGACGGCACCCGGGAAGGACCCCGCCACGCCACGCCCCGTGGCCCGCCAGCGGCGCCAC
ACGCTGAGCTTCCTGGAGGAGATCCGGTCGTTCTCGCCGGTCTTCCTCGACACGGCCGTC
GACATGACCAGCATCCGTGAGCACCGGGCCGCCGCCCGCGCCCCCGGCCGCCGCTACTCC
ACGACCGCGTACGTCCTGCACACCGCCGCCCGTGTGCTGGCCCGGCACCCCGAGGCGAAC
GCCGCGATCCGCGGCCGGGCCCGGCCGCGGATCGCCCGCTACGAGGGCGTGCACGGCAAG
CTCGCCCTGGACCGGTTCCTGGACGGCCAGCGCGTGGTGCTCTCCACGGTGCTGCGCGAC
CTGGAGCAAACCGGTCTGACCGGCATCCAGGACCGTATCGACCACTTCCGCCGCGGCGAT
CCGGGGACCATGGCCGAGTTCGCCCCGACGCGCGCGCTGCAACGGCTGCCGTGGCCGCTG
CGCACCCTGGCGTTCCGCGCCGGCACCCGCCCGCTGGGCCGGCGGCCCGCCGTGATGGGC
ACCTTCGCCGTCACCTCTCTCGGGCACCGCCCGGTGGACGGCTTCTACTCGGTGGGCGGG
ACGACGATCACGCTCGGGCTGGGCTCGACGGCCGACCGGCCGGTGGTCCGGGACGGGCGG
CTCGGTGTCGCGCCGCTGATGCGGCTCAGCCTCACCTTCGACCACCGGGTCATCGACGGC
GCCGAGGCCGCCGACGTGCTCGCGGAGATCAAAGAGGGACTGGAATCGTTCAAGGACGTG
GGGGACGAGGACGTATGCACGACGTCGTCGAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001078 2-oxoacid dehydrogenase acyltransferase, catalytic domain (Domain)
 [12-135]  1.9e-06 PF00198 [167-258]  9.10000000000001e-17 PF00198
PF00198   2-oxoacid_dh
IPR023213 Chloramphenicol acetyltransferase-like domain (Domain)
 [8-257]  6.29999999999998e-37 G3DSA:3.30.559.10
G3DSA:3.30.559.10   CAT-like_dom
SignalP No significant hit
TMHMM No significant hit