close all open/close all

CDS information : Chth_00390


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction104,713 / 105,801 / + [in whole cluster]
104,713 / 105,801 / + [in contig]
Location104713..105801 [in whole cluster]
104713..105801 [in contig]
TypeCDS
Length1,089 bp (362 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Producthypothetical protein
Product (GenBank)ChlD4
Gene
Gene (GenBank)chlD4
EC number
Keyword
  • glyceroyl-CoA
Note
Note (GenBank)
  • predicted hydrolase or acyltransferase
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)
Related Reference
ACC
B3TMQ0
PmId
[17985890] Elucidation of the kijanimicin gene cluster: insights into the biosynthesis of spirotetronate antibiotics and nitrosugars. (J Am Chem Soc. , 2007)
ACC
B5L6L6
PmId
[18586939] Cloning and characterization of the tetrocarcin A gene cluster from Micromonospora chalcea NRRL 11289 reveals a highly conserved strategy for tetronate biosynthesis in spirotetronate antibiotics. (J Bacteriol. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [ChlD4]
MHDVVELKRYVEVHARGQRIQGYRDILGRIGSDEGDGPGTWVAEWSRAGEDLAREGRPLE
ASRHFAMARFPYVDGPGRHRALERCAQTLEEWQRERAPELERLDVVLPGGRVRCWSTGLS
TTRRLPLVLIMGGIVTVKEQWVPALVRLRRLGLAAVVTEMPGVGENTLPYDAKSWRMLSG
ILDTVADRARVERTYAMALSFSGHMALRCALDDARLRGVVTVGAPVHDFFTDARWQARVP
RITVDTLARLTDGTPRHVLGHMADFALGDEQLAALEIPVHYTASLRDEIIPGSETRRLRD
HVRALTLLEHDDVHGAPRHTAETQLWCVRSLLRMEQPRGPRAAVLDLMWRAARARRRLAP
RS
selected fasta
>hypothetical protein [ChlD4]
ATGCACGACGTCGTCGAGCTGAAGCGGTATGTCGAGGTGCACGCCCGGGGCCAGCGCATC
CAGGGCTACCGCGACATCCTCGGCCGGATCGGCTCCGACGAGGGCGACGGCCCCGGCACC
TGGGTGGCGGAGTGGTCGCGGGCCGGCGAAGACCTCGCGCGCGAGGGCCGCCCGCTGGAG
GCGTCACGGCACTTCGCCATGGCGCGCTTCCCCTACGTCGACGGGCCCGGACGCCACCGC
GCGCTGGAGCGCTGCGCGCAGACCCTGGAGGAGTGGCAGCGCGAGCGGGCGCCCGAACTG
GAGCGTCTCGACGTCGTGTTGCCCGGCGGGCGCGTCCGCTGCTGGAGCACGGGCCTGTCC
ACCACCCGGCGCCTCCCGCTGGTGCTGATCATGGGCGGGATCGTCACCGTGAAGGAGCAG
TGGGTGCCCGCGCTCGTCCGGCTGCGGCGGCTGGGCCTGGCGGCGGTCGTCACCGAGATG
CCCGGGGTCGGCGAGAACACCCTCCCCTACGACGCGAAGAGCTGGCGCATGCTGTCCGGG
ATCCTCGACACGGTCGCCGACCGGGCCCGCGTCGAGCGGACCTATGCCATGGCGCTGAGC
TTCAGCGGCCATATGGCCCTGCGGTGTGCCCTGGACGACGCCCGGCTGCGGGGTGTCGTG
ACCGTCGGGGCGCCGGTGCACGACTTCTTCACCGACGCCCGCTGGCAGGCTCGTGTCCCC
CGGATCACCGTGGACACCCTGGCCCGGCTCACCGATGGCACACCGCGTCATGTCCTCGGC
CATATGGCCGACTTCGCCCTCGGCGACGAGCAGCTCGCGGCCCTGGAGATACCCGTGCAC
TACACGGCCAGCCTCCGTGACGAGATCATCCCGGGCAGCGAAACACGCCGGCTGCGCGAC
CATGTGCGCGCGCTCACCCTGCTGGAGCACGACGATGTGCACGGCGCCCCGCGGCACACG
GCGGAGACCCAGCTGTGGTGCGTCCGGTCCCTGCTGCGCATGGAACAGCCCCGCGGCCCG
CGCGCCGCCGTCCTGGACCTGATGTGGCGGGCGGCCCGCGCCCGACGGCGCCTCGCTCCC
CGTTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit