close all open/close all

CDS information : Chth_00400


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction106,484 / 106,089 / - [in whole cluster]
106,484 / 106,089 / - [in contig]
Locationcomplement(106089..106484) [in whole cluster]
complement(106089..106484) [in contig]
TypeCDS
Length396 bp (131 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)peptidase M20
Gene
Gene (GenBank)orf36
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in chlorothricin biosynthesis.
Note (GenBank)
  • Orf36
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)

close this sectionSequence

selected fasta
>hypothetical protein [peptidase M20]
MLQDWLAARVLPHRRLHDATGALVGLLIPGGRPGSWWTLDACVETAPYGDETAWSFPPAS
GDIVDGWLRGRGSSDSKLAAAMFCHIAADLAPAHTNARAGSPCSWTSMSTPAASAALAPT
SPTRPRLARPG
selected fasta
>hypothetical protein [peptidase M20]
GTGCTGCAGGACTGGCTCGCCGCCCGCGTGCTGCCGCACCGGCGCCTGCACGATGCGACG
GGCGCCCTGGTGGGGCTGCTGATTCCCGGCGGGCGGCCCGGATCGTGGTGGACGCTGGAC
GCGTGCGTGGAGACCGCCCCGTACGGCGATGAGACGGCCTGGTCCTTCCCGCCCGCATCC
GGTGACATCGTGGACGGCTGGCTGCGCGGCCGTGGCTCGTCAGACTCCAAGCTCGCCGCC
GCGATGTTCTGCCACATCGCCGCCGACCTCGCCCCCGCGCACACGAACGCGCGGGCGGGC
TCGCCGTGCTCCTGGACGTCGATGAGCACACCGGCGGCTTCGGCGGCGCTCGCGCCCACC
TCGCCGACCCGGCCGCGGCTCGCCCGGCCGGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-33]  0.574 Signal
Eukaryota   
TMHMM No significant hit