close all open/close all

CDS information : Chth_00410


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction110,125 / 107,684 / - [in whole cluster]
110,125 / 107,684 / - [in contig]
Locationcomplement(107684..110125) [in whole cluster]
complement(107684..110125) [in contig]
TypeCDS
Length2,442 bp (813 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative helicase
Product (GenBank)putative helicase
Gene
Gene (GenBank)orf37
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in chlorothricin biosynthesis.
Note (GenBank)
  • orf37
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)
Family/Domain
FD
IPR001650
FD
IPR006935

close this sectionSequence

selected fasta
>putative helicase [putative helicase]
MTVVALPRPGRPGRAQLFPDQADAVDRLVRHLRRPGTRALFVSATGTGKTLVSIRVADGL
GARLVLFVVPTLDLAAQTALAWRRDGHGEHMVIVSSLDTAGRDDLVAARIMSTTDPHALG
GLMSVVGEAEDQIPALTVICTYDSLNKIEETRKTGYAVPPFDLAVMDEAHRIAGRADKKW
AIVNDAQRIHADRRLYMTATPRIFAAPELAESADTTRPRRRRTTGPELDAFANSMDNEQV
YGKKVVEYPLAQAVADGRAADYRIVVPTLTDTDLRRRLNLPAPGSANPGATVAREEKDDG
ALRTTALHLAVVRAMTEHGLKKVLVYFNLVSGARRFARELPHTLRLLAQTDPGLVPDTTP
QLFFAHGEHTPAQRADIFTAFAAADTAILANSRLIAEGVDIPSVDAIVFADPTRSVIRCV
QALGRALRLDVSGKTASLIVPVYIPPGADAENILGTAYEPVWAIACALASHDHRILERLP
DKANRLPKETSDVIARRWHFDFTVHPERIARAMDLASFDPRDPAVSRSRRLGLAAAQSYH
DEHGHLDVPTDYTDPTGYALGTFITTMRDARTAGRLEAGWIAELDALGMIWDKHDAAWRA
RLAAAADYLRTHGHLAAPATTPVGAWLAEQRHLATKGELGPARADALTALAPDWRLPHGA
DWHRKYHLLRAHLADGADPGALTRDTLLHGVKIGSWLHRQLTTWHALRRSQQQLLISLGL
TPASNPLAPARRTRRTFEQTVQLLELFLHREGRAPTAREEITVDGERVKIGPWLAKARTK
HRSGQLPDEHARLVAALFDGDWTNDAAVPVSLG
selected fasta
>putative helicase [putative helicase]
ATGACTGTGGTGGCACTGCCGCGCCCCGGCCGCCCCGGGCGCGCGCAGCTTTTCCCCGAT
CAGGCGGACGCGGTGGACCGGCTCGTACGGCACCTGCGCCGCCCGGGGACGCGGGCCCTG
TTCGTGTCGGCGACGGGCACCGGCAAGACGCTGGTGTCCATCCGGGTGGCGGACGGACTC
GGCGCACGGCTGGTGCTGTTCGTGGTGCCCACCCTCGACCTCGCGGCGCAGACGGCGCTG
GCCTGGCGCCGGGACGGCCACGGCGAGCACATGGTGATCGTCTCCTCCCTGGACACCGCG
GGCCGCGACGACCTGGTCGCGGCCCGGATCATGTCGACCACCGATCCGCATGCGCTGGGC
GGGCTGATGTCGGTGGTGGGGGAGGCAGAAGACCAGATCCCGGCCCTGACGGTGATCTGC
ACCTACGACTCCCTGAACAAGATCGAGGAGACCCGGAAGACGGGGTATGCCGTCCCGCCG
TTCGACCTCGCGGTCATGGACGAAGCGCACCGGATCGCCGGCCGGGCCGACAAGAAGTGG
GCGATCGTCAACGACGCGCAGCGTATCCACGCGGACCGCCGTCTCTACATGACCGCCACC
CCGCGCATCTTCGCCGCTCCCGAGCTGGCCGAGTCCGCCGACACCACCCGCCCCCGCCGC
CGGCGTACCACCGGCCCGGAGCTGGATGCGTTCGCCAACTCCATGGACAACGAGCAGGTG
TACGGCAAGAAGGTCGTCGAATACCCCCTCGCGCAGGCCGTGGCGGACGGCCGGGCGGCG
GACTACCGCATCGTGGTGCCCACCCTCACCGACACCGACCTGCGCCGCCGCCTGAACCTG
CCCGCCCCCGGCAGCGCGAACCCCGGCGCCACCGTGGCCCGGGAGGAGAAGGACGACGGC
GCGCTGCGCACCACCGCCCTGCACCTGGCCGTCGTGCGCGCCATGACCGAGCACGGCCTC
AAAAAAGTCCTGGTCTACTTCAACCTCGTCTCCGGCGCCCGCCGCTTCGCCCGTGAACTC
CCGCACACCCTGCGCCTGCTGGCCCAAACCGACCCCGGCCTCGTCCCGGACACCACCCCC
CAGCTGTTCTTCGCCCACGGCGAGCACACCCCCGCCCAACGCGCCGACATCTTCACCGCG
TTCGCCGCCGCCGACACCGCGATCCTCGCCAACTCCCGCCTGATCGCCGAAGGCGTCGAC
ATCCCCAGCGTCGACGCCATCGTCTTCGCCGACCCCACCCGCAGCGTCATCCGCTGCGTC
CAGGCCCTCGGCCGCGCCCTGCGCCTCGATGTCTCAGGCAAGACCGCCTCACTGATCGTC
CCCGTCTACATCCCGCCCGGCGCCGACGCCGAGAACATCCTCGGCACCGCCTACGAGCCG
GTGTGGGCGATCGCGTGCGCACTGGCCAGCCACGACCACCGCATCCTCGAACGCCTCCCC
GACAAGGCCAACCGGCTCCCGAAGGAGACCAGCGACGTCATCGCCCGCCGCTGGCACTTC
GACTTCACCGTCCACCCCGAACGCATCGCCCGCGCCATGGACCTGGCATCCTTCGACCCC
CGCGACCCGGCCGTCTCCCGCTCCCGCCGGCTCGGGCTCGCCGCCGCCCAGTCCTACCAC
GACGAACACGGCCACCTCGACGTCCCCACCGACTACACCGACCCCACCGGCTACGCGCTC
GGCACCTTCATCACCACCATGCGCGACGCCCGCACCGCCGGCCGCCTCGAAGCCGGCTGG
ATCGCCGAACTCGACGCCCTCGGCATGATCTGGGACAAGCACGACGCCGCCTGGCGCGCC
CGCCTGGCCGCCGCAGCCGACTACCTGCGAACCCACGGCCACCTCGCCGCCCCCGCCACC
ACTCCCGTCGGCGCCTGGCTCGCCGAACAACGCCACCTCGCCACCAAGGGCGAACTCGGC
CCGGCCCGCGCCGACGCCCTGACCGCCCTCGCCCCCGACTGGCGCCTGCCCCACGGCGCG
GACTGGCACCGCAAATACCACCTGCTGCGCGCCCACCTCGCCGACGGCGCCGACCCCGGC
GCCCTCACCCGCGACACCCTCCTGCACGGCGTGAAGATCGGCTCCTGGCTGCACCGCCAA
CTGACCACCTGGCACGCCCTCCGCCGCAGTCAGCAGCAGCTGCTGATCTCCCTCGGCCTG
ACCCCCGCCAGCAACCCGCTCGCCCCGGCGCGCCGCACCCGCCGCACCTTTGAACAGACC
GTCCAACTCCTGGAACTCTTCCTCCACCGCGAAGGCCGCGCCCCGACCGCCCGTGAGGAG
ATCACCGTCGACGGCGAGCGCGTCAAGATCGGCCCGTGGCTCGCCAAGGCCCGCACCAAG
CACCGCTCCGGCCAACTCCCCGACGAGCATGCCCGCTTGGTCGCCGCGCTCTTCGACGGC
GACTGGACCAACGACGCCGCCGTGCCCGTCTCCCTCGGATAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001650 Helicase, C-terminal (Domain)
 [338-430]  7.80000016938413e-11 SM00490
SM00490   HELICc
 [364-428]  6.80000000000001e-12 PF00271
PF00271   Helicase_C
 [310-494]  PS51194
PS51194   HELICASE_CTER
IPR005114 Helicase-associated (Domain)
 [530-589]  4.1e-13 PF03457 [591-652]  1.1e-13 PF03457
PF03457   HA
IPR006935 Helicase/UvrB domain (Domain)
 [16-202]  2.6e-17 PF04851
PF04851   ResIII
IPR014001 Helicase, superfamily 1/2, ATP-binding domain (Domain)
 [13-231]  5.59999989417023e-14 SM00487
SM00487   DEXDc
 [30-219]  PS51192
PS51192   HELICASE_ATP_BIND_1
SignalP
 [1-15]  0.104 Signal
Bacteria, Gram-negative   
 [1-41]  0.201 Signal
Bacteria, Gram-positive   
TMHMM No significant hit