close all open/close all

CDS information : Chth_00420


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction111,268 / 110,144 / - [in whole cluster]
111,268 / 110,144 / - [in contig]
Locationcomplement(110144..111268) [in whole cluster]
complement(110144..111268) [in contig]
TypeCDS
Length1,125 bp (374 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)ankyrin
Gene
Gene (GenBank)orf38
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in chlorothricin biosynthesis.
Note (GenBank)
  • orf38
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)

close this sectionSequence

selected fasta
>hypothetical protein [ankyrin]
MFSAYVSCPGGRVRSPRPGLSASGRGGREVRLPSPCSRAGTRRVARETCDVFEGERMTIE
SDGWAGMGWDWTDADDIRRRLDEGADPEKWSGGRPLHRAAVFGSPEAVAVLARRVADVDA
LENGVTALWEAVMSRKPANARALAAAGADPWRLSLGGWSPGRLSLAGPTPELFPVPEGIS
LTDTERAAAQEAHRLTTALGEFYYDGTGLACVAGIDAAEAVRRLEATPADGALVDELLEE
PYAYDMDESLHIVGVTSVPGGCVVTQPWGYAPSMPGVLARLSAGTLCYGLYANPKSGNQG
RIARHGTIEGSDLHPGGEPDENDTSEQVLASYLYQNNAVAYACAVAELRLHDRRAVTGPP
DVWVELPRRDYWSH
selected fasta
>hypothetical protein [ankyrin]
GTGTTTTCAGCGTACGTATCGTGTCCGGGTGGTAGGGTCCGGTCACCGAGACCTGGACTG
TCTGCCAGCGGCCGGGGGGGGCGTGAAGTGCGCTTGCCGTCGCCCTGTTCCCGGGCGGGA
ACGCGCCGGGTGGCGCGAGAGACGTGCGACGTGTTCGAGGGGGAGCGGATGACAATCGAG
AGCGATGGCTGGGCCGGCATGGGCTGGGACTGGACGGATGCCGACGACATCCGCCGGCGC
CTCGACGAAGGCGCCGATCCGGAAAAATGGAGCGGGGGCCGGCCCCTGCATCGGGCAGCG
GTCTTCGGCTCCCCGGAAGCCGTCGCCGTGCTGGCCCGCCGGGTTGCGGATGTGGACGCG
CTGGAGAACGGGGTGACGGCGCTGTGGGAAGCCGTCATGTCCAGGAAGCCGGCCAACGCA
CGAGCGCTCGCCGCCGCCGGGGCCGATCCCTGGCGGCTGTCACTCGGCGGCTGGTCACCG
GGGCGGCTGAGCCTGGCCGGACCGACGCCCGAGCTGTTCCCGGTACCGGAAGGGATATCC
CTGACCGACACCGAGCGGGCGGCAGCGCAGGAAGCCCATCGGCTCACCACGGCGCTGGGT
GAGTTCTACTACGACGGCACAGGCCTGGCCTGCGTGGCCGGCATCGACGCGGCCGAGGCG
GTGCGCCGTCTTGAGGCGACGCCGGCGGACGGCGCACTCGTCGATGAGCTGCTGGAGGAG
CCCTACGCGTACGACATGGACGAGAGCCTGCACATCGTCGGCGTGACGTCCGTGCCGGGC
GGCTGCGTCGTCACCCAGCCCTGGGGATATGCGCCGAGCATGCCCGGTGTGCTGGCCCGG
TTGTCCGCCGGCACTCTTTGCTACGGCCTGTACGCCAATCCCAAGAGCGGCAACCAGGGC
AGAATCGCCCGTCACGGAACCATCGAGGGCTCAGACCTGCACCCCGGCGGAGAACCGGAC
GAGAACGACACCTCCGAGCAGGTGCTGGCCTCATACCTCTACCAGAACAACGCCGTCGCC
TACGCCTGCGCTGTCGCGGAACTGCGTCTGCACGACCGGCGCGCCGTGACCGGACCGCCC
GATGTGTGGGTCGAACTGCCTCGCCGCGACTACTGGAGTCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002110 Ankyrin repeat (Repeat)
 [91-120]  0.450000003859273 SM00248 [123-152]  2.09999994030551 SM00248
SM00248   ANK
 [91-123]  PS50088
PS50088   ANK_REPEAT
IPR020683 Ankyrin repeat-containing domain (Domain)
 [91-123]  PS50297
PS50297   ANK_REP_REGION
 [81-160]  1.6e-09 G3DSA:1.25.40.20 [209-233]  1.6e-09 G3DSA:1.25.40.20
G3DSA:1.25.40.20   ANK
 [81-150]  1.2e-06 PF12796
PF12796   Ank_2
 [90-166]  6.40000038788486e-09 SSF48403
SSF48403   ANK
SignalP
 [1-39]  0.318 Signal
Bacteria, Gram-negative   
TMHMM No significant hit